Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

lpg0742

Victor ID 1435
Gene Name lpg0742
Sequence Strain (Species/Organism) Legionella pneumophila subsp. pneumophila str. Philadelphia 1
NCBI Gene ID 3078198
NCBI Protein GI 52840979
Locus Tag lpg0742
Genbank Accession AE017354
Protein Accession YP_094778
Other Database IDs UniProtKB-ID: Q5ZXI9_LEGPH
UniRef100: UniRef100_Q5ZXI9
UniRef90: UniRef90_Q5ZXI9
UniRef50: UniRef50_Q5ZXI9
UniParc: UPI0000442327
EMBL: AE017354
EMBL-CDS: AAU26831.1
RefSeq_NT: NC_002942.5
GenomeReviews: AE017354_GR
KEGG: lpn:lpg0742
eggNOG: NOG85723
HOGENOM: HBG519984
OMA: VINVELY
ProtClustDB: CLSK832371
BioCyc: LPNE272624:LPG0742-MONOMER
Taxonomy ID 272624
Gene Starting Position 811163
Gene Ending Position 812416
Gene Strand (Orientation) +
Protein Name hypothetical protein
Protein pI 9.36
Protein Weight 46152.14
Protein Length 417
DNA Sequence
>gi|52840256:811163-812416 Legionella pneumophila subsp. pneumophila str. Philadelphia 1 chromosome, complete genome
CGTGAGTGTCTGGCTATTTCATACAATCGATCCTAAGTGCTATAGTATTCATTTACAAAGAAATATAATG
AAAACCATGAAGCAAATGATTCGATTGACAATGTTACTTCTGATGCTCAGTTTTAATTTATGGGCAATAA
ATTCTTCATCTCCCTGGTATACAGAAGAAAAAGGTAAAGGGCTTGTAATTAACGTTGAATTGTATCTTTC
ATCTACTTGTCCTCATTGTCATAAGGCCGATGAATTTTTCAAAGAAATTGAAAAACATTATACCTGGTTG
CATGTTGAGCGTTATATTATTGATAAAGATAAAAAGGCTTTGAAACGCTTTGGCGATTTATTGACAGAAC
TTAATCGATATGATTTTGCCGTTCCATCCATATTTTTTTGTAATTCCCGTTGGGTTGGGTTTGCTACTGC
ACAGACAACCGGAAAGGATCTGTTAAACGGCATAGAATATTGTAAAGAAGAAATTGTGAAAAATGGAAGA
TTGACTCCTGCGACCGAGAATGTTTTAAACAGATGGGGGAATGCGAGTTTGTTTGATTCCAATATCACAG
GAAGCCCTTCCACAAATACATTTATTTTTGTTGTAGCCATAATCGATGCAATCAGTCCATGTGCTTTATT
TACGATTACTGCATTTTTAGGTCTTTTATTCATGATTGAAAAGCGAAAGCTGCAATTTATTAGCGGTTCC
GTGTTTATTTTAACTGTTGCAGGTGTTCATTATTTTCAACAGGTTTATCCTACCCTGTTTTTTGAGTCGC
TTTCATGGTTCCGTATTCCGGCTGCATTGGTAGGCCTTTTTGCTTTTTATTTCGCTGGCCAATATTATAA
AAAGCATTCTATCCAACCATTATTTATTGTTTTGGCTTTTTTATTGGCTCTTACAGTGCCAATGTTTCAA
CAAACCTGTTTGATGAATTGGTCTTATGTGTTTGAACAATGGTTACATAACCAAAATGTATCAGGAGTTC
AGATGGGGCTATATCAATTTGCTTATCAGCTTATCTATATCTTTCCTTTAATTATCCTGATGTTTCTCTA
TTGGATTTTAATGAAAATTCATTTTTTCAAAAAATTTAAGACAAAATTAACTACTATAGGTTTTTTATAT
ATTTTAGCTATCGCACTCTTATTAATCGTTTATCCCTATGCCTTGTCTAATTTGGCTTTATCATTATTTT
TAATTGTCTCATTGGGGATCTCCGGTCTGTTACTGAATTGGTTTAATGCTTCTAAAATGACATG

Protein Sequence
>gi|52840979|ref|YP_094778.1| hypothetical protein lpg0742 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
MSVWLFHTIDPKCYSIHLQRNIMKTMKQMIRLTMLLLMLSFNLWAINSSSPWYTEEKGKGLVINVELYLS
STCPHCHKADEFFKEIEKHYTWLHVERYIIDKDKKALKRFGDLLTELNRYDFAVPSIFFCNSRWVGFATA
QTTGKDLLNGIEYCKEEIVKNGRLTPATENVLNRWGNASLFDSNITGSPSTNTFIFVVAIIDAISPCALF
TITAFLGLLFMIEKRKLQFISGSVFILTVAGVHYFQQVYPTLFFESLSWFRIPAALVGLFAFYFAGQYYK
KHSIQPLFIVLAFLLALTVPMFQQTCLMNWSYVFEQWLHNQNVSGVQMGLYQFAYQLIYIFPLIILMFLY
WILMKIHFFKKFKTKLTTIGFLYILAIALLLIVYPYALSNLALSLFLIVSLGISGLLLNWFNASKMT

Molecule Role Virulence factor
Molecule Role Annotation MUTATION: ldsA (lpg0742) mutant is attenuated in mouse macrophages (Vincent et al., 2006).
References
Vincent et al., 2006: Vincent CD, Buscher BA, Friedman JR, Williams LA, Bardill P, Vogel JP. Identification of non-dot/icm suppressors of the Legionella pneumophila DeltadotL lethality phenotype. Journal of bacteriology. 2006; 188(23); 8231-8243. [PubMed: 16997951].