Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

lpg1905

Victor ID 1438
Gene Name lpg1905
Sequence Strain (Species/Organism) Legionella pneumophila subsp. pneumophila str. Philadelphia 1
NCBI Gene ID 3078951
NCBI Protein GI 52842123
Locus Tag lpg1905
Genbank Accession AE017354
Protein Accession YP_095922
Other Database IDs UniProtKB-ID: Q5ZUA2_LEGPH
UniRef100: UniRef100_Q5ZUA2
UniRef90: UniRef90_Q5ZUA2
UniRef50: UniRef50_Q5ZUA2
UniParc: UPI000044275C
EMBL: AE017354
EMBL-CDS: AAU27975.1
RefSeq_NT: NC_002942.5
PDB: 3AAP
PDB: 3AAQ
PDB: 3AAR
GenomeReviews: AE017354_GR
KEGG: lpn:lpg1905
NMPDR: fig|272624.3.peg.734
eggNOG: COG5371
HOGENOM: HBG519422
OMA: HFENSEL
ProtClustDB: CLSK821844
BioCyc: LPNE272624:LPG1905-MONOMER
Taxonomy ID 272624
Gene Starting Position 2124888
Gene Ending Position 2126069
Gene Strand (Orientation) +
Protein Name ectonucleoside triphosphate diphosphohydrolase I
Protein pI 4.8
Protein Weight 42545.57
Protein Length 393
DNA Sequence
>gi|52840256:2124888-2126069 Legionella pneumophila subsp. pneumophila str. Philadelphia 1 chromosome, complete genome
AATGTACCATTCGAAAACTTCAATTTTGGCTCTATATCAACTAATGTTTCGAGTTTTAATTTTTCTTTCT
TGCCTAGTAATTTTGACGCCAAACACTATTGCTGACACTAACCCCTGTGAAAAACACTCTTGTATAGCTG
TCATTGATGCCGGAAGTACTGGTTCCAGGCTACATATCTACTCCTATGATACGGATGACACCAATACTCC
AATTCATATTGAGGAAATTTGGAATAAAAAAATCAAACCTGGATTCGCAAGCATACAGCCTAATTCCGTA
ACAATTGATGCCTACCTGACAATGCTATTGGCTGATGCACCAATTCATAATATACCTGTTTACTTTTACG
CAACAGCAGGTATGCGACTACTACCCCAATCACAACAAAAAAAATACTATGATGAATTGGAGTACTGGTT
TAGACAACAATCGCAATGGCAGTTGGCCGAGGCAAAAACTATCACTGGGAACGACGAAGCATTGTTTGAC
TGGCTTGCTGTAAATTATAAACTTGATACATTAAAATCAGTCCAAAATAAATCAGTTGGCGTCATGGATA
TGGGCGGCGCTTCCGTTCAAATTGTCTTTCCAATGCCTAAAAATGCGGAGATTAGCAAACATAACCAGGT
AGAGCTCAATATCTATGGACAGAATATCAATCTGTATGTTCACAGTTTCCTGGGGTTAGGCCAAACAGAA
ATGTCACATCAATTCCTTAACTCCCCCTCTTGCTTTGCAAACGACTATCCTTTGCCGGACGGGGAGTCAG
GACAGGGCAATGCTCCATCGTGCAAGGAAGAAGTAACCTCATTAATGAATAGTGTCCATAAGGTAAATCA
ACAAATACAACCTTTGCTTGCTTTAAATCCCGTGAATGAATGGTACAGTATTGGTGGTATTTCCAATCTT
GCCAGCAGCCAATTATTTCATTTTGAAAACAGCGAACTCACTAATCAAAGTTTGCTGCAACAAGGGGACA
ACCAAATTTGCCATCAGCAATGGGATATACTTAATGGCCAGTATCCTGACGATGAGTACCTCTACCAATA
TTGTCTTTTATCCTCTTATTACTACGCATTAATGGTGGATGGTTATGGCATTAACCCCAATCAAACCATC
CATTATATTCCGCCAGAACAAAATCTCGATTGGACAATTGGAGTCGTGCTTCACCGCGCTTG

Protein Sequence
>gi|52842123|ref|YP_095922.1| ectonucleoside triphosphate diphosphohydrolase I [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
MYHSKTSILALYQLMFRVLIFLSCLVILTPNTIADTNPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTP
IHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELEYWF
RQQSQWQLAEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQV
ELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQ
QIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQY
CLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRA

Molecule Role Virulence factor
Molecule Role Annotation MUTATION: lpg1905 mutant is attenuated in macrophages and human alveolar cells (Sansom et al., 2007).
COG COG5371GO, under G: Carbohydrate transport and metabolism; O: Posttranslational modification, protein turnover, chaperones
References
Sansom et al., 2007: Sansom FM, Newton HJ, Crikis S, Cianciotto NP, Cowan PJ, d'Apice AJ, Hartland EL. A bacterial ecto-triphosphate diphosphohydrolase similar to human CD39 is essential for intracellular multiplication of Legionella pneumophila. Cellular microbiology. 2007; 9(8); 1922-1935. [PubMed: 17388784].