Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

lpg2155

Victor ID 1439
Gene Name lpg2155
Sequence Strain (Species/Organism) Legionella pneumophila subsp. pneumophila str. Philadelphia 1
NCBI Gene ID 3078981
NCBI Protein GI 52842369
Locus Tag lpg2155
Genbank Accession AE017354
Protein Accession YP_096168
Other Database IDs UniProtKB-ID: Q5ZTK6_LEGPH
UniRef100: UniRef100_Q5ZTK6
UniRef90: UniRef90_E1XYY5
UniRef50: UniRef50_E1XYY5
UniParc: UPI0000442846
EMBL: AE017354
EMBL-CDS: AAU28221.1
RefSeq_NT: NC_002942.5
GenomeReviews: AE017354_GR
KEGG: lpn:lpg2155
NMPDR: fig|272624.3.peg.998
HOGENOM: HBG519539
OMA: EDEREDK
ProtClustDB: CLSK833218
BioCyc: LPNE272624:LPG2155-MONOMER
Taxonomy ID 272624
Gene Starting Position 2407666
Gene Ending Position 2410287
Gene Strand (Orientation) +
Protein Name hypothetical protein
Protein pI 7.09
Protein Weight 95535.59
Protein Length 873
DNA Sequence
>gi|52840256:2407666-2410287 Legionella pneumophila subsp. pneumophila str. Philadelphia 1 chromosome, complete genome
TATGTTTGGTTTCATAAAGAAAGTACTTGATTTTTTTGGTGTTGATCAATCTGAAGATAATCCATCTGAG
ACTGCGGTGGAAACAACCGATGTTTCAACAAAAATCAAAACCACTGACACCACCCAGGAAGAGAGTTCAG
TCAAAACCAAAACGGTTGTTCCTACCCAACCTGGGGGTTCTGTCAAACCCGAGACAATCGCACCTGACCA
ACAAAAAAAACACCAAATAAAAACAGAAACGACTACAAGCACAACCAAACAAAAAGGCCCCAAAGTAACA
CTAATGGATGGTCACGTGAAACAATATTATTTTGCCCGGCGAGGTGAAACAAGCACTCATGACACCTCTC
TGCCACCACCTGTGAAGGTGTTAAGTGGGCGCTCTATCCCATTAAAAGAAATTCCTTTTGAAGCTACCAG
AAATGAATTAGTCCAGATTTATCTCACTTCTATTGATAAACTCATCAAAAGCAACAAATTAAACTCTATT
CCATCACAACAAATCGCCTCTCACTATCTCTTTCTTAGATCACTTGCCAACTCAGAGACTGATGGAATTA
AAAAAAATCAAATACTGTCATTAGCCAAGCCATTGGGCACTTACCTTGCCTCTAAAGAGCCCCATGTATG
GAAAATGATCAATGAACTCATTGAAAAAAGTGAATACCCAATTATTCATTATTTAAAAAATAACCGTGCT
CATTCCAATTTCATGCTGGCATTAATTCATGAGTATCATAAGGAACCATTAACCAAAAACCAAAGCGCCT
TTGTACAAAAATTTAGGGACTCCTCTGTCTTTCTCTTCCCTAACCCAATTTATACAGCATGGCTCGCTCA
TTCCTATGATGAGGACTCCAGCTTTAATCCTATGTTTCGTGAAAGATTATCCACCAACTTTTATCATTCC
ACTCTGACCGATAATCTCTTGTTAAGAACAGAACCTAAGGAAGTAACTCTTTCATCAGAGCATCATTATA
AAAAGGAAAAAGGACCAATTGACTCGTCTTTTCGTTATCAAATGTCAAGTGATCGGTTATTGCGTATCCA
GGGCAGAACTTTACTGTTTAGTACCCCCCAAAATGATGTGGTTGCAGTCAAAGTACAAAAAAAAGGAGAG
CCTAAGTCCACCTTGGAAGAAGAATTCGAAATGGCAGATTATTTGCTGAAACATCAACGTCGTTTGGATG
TACACAGCAAATTGCCACAACCGCTTGGACAATACTCTGTTAAAAAATCAGAGATTTTGGAAATAAGCAG
GGGATCATTAGATTTTGAGCGTTTTAAAACCTTAATAGACGACTCTAAAGACCTTGAAGTGTATGTTTAT
AAAGCCCCCCAGTCTTATTTCACTTACCTACACGATAAAAATCAGGATTTGGAAGATCTGACAGCTTCTG
TTAAAACAAATGTGCACGATCTCTTTGTTCTATTACGCGAAGGAATCGTATTTCCCCAATTAGCCGATAT
CTTCCATACTCATTTTGGTGAAGACGAGCGCGAAGACAAAGGAAGATACCAGGCATTAGTTCAACTTTTG
AATGTTTTACAGTTCCAATTAGGGCGCATTGATAAATGGCAAAAAGCTGTGGAATACGTCAATTTGCGCA
GCAGTGGTCTGGCTGATTTGGGAGACAGTCTGCCCATAACTAGCCTGTTCACTTCATCTGATTTCACAAA
ACATTATTTCTCTGAACTGCTTACAGGAGGATATCACCCAACCTTCTTTGACAAGTCATCTGGTACAGCC
AACTCTTTATTCACCGGCAAGCGCCGATTATTTGGTAATTACTTGTATCTCAATACCATAGCAGAATATT
TGCTGGTTATTCAGTTAACACTCGGCAGCTATGGGGATAAAGTGACTCGAGACATGATGGATAAACCTAA
AAAAGAGGCGGTATGGCGAGAATTGGCAAACGTCATGTTTACAAGTTGTGCAGAAGCCATTCATATCATG
ACTGGAATACCTCAATCGCGAGCACTGACACTACTAAAACAACGAGCTAATATTGAAAAACATTTCAGAC
AGACACAATTCTGGATGACGCCTGATTATTCCAAACTGGATGAAGATACACTGCAAATGGAGCAATACAG
CATTTATTCCGGTGAGCCAGAATATGAATTCACTGATAAATTAGTCTCTGGTGTTGGATTGTCCGTCGAT
GGTGTTCATCAGGACTTGGGTGGATATAACAGGGAAAGCCCATTAAGAGAACTTGAAAAACTGCTCTATG
CCACAGTAACACTGATTGAAGGAACCATGCAACTTGATAAAGAGTTTTTTAAACAATTGGAACAAGTTGA
AAAAATACTTTCTGGTGAGATAAAAACTGATGCCAATTCGTGCTTTGAAGCAGTTGCCCAACTTCTGGAC
CTTGCAAGGCCTGGGTGCCATTTTCAGAAAAGATTGGTTTTGTCCTACTACGAAGAAGCCAAGCTTAAAT
ATCCCTCCGCACCAACTGACGCCTATGATTCACGTTTTCAAGTAGTCGCCAGAACCAATGCCGCAATAAC
CATTCAACGATTCTGGCGAGAAGCACGCAAAAACTTGTCAGAAAAATCGGATATCGATTCTGAAAAGCCG
GAATCCGAACGTACTACTGATAAACGTTTGTG

Protein Sequence
>gi|52842369|ref|YP_096168.1| hypothetical protein lpg2155 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
MFGFIKKVLDFFGVDQSEDNPSETAVETTDVSTKIKTTDTTQEESSVKTKTVVPTQPGGSVKPETIAPDQ
QKKHQIKTETTTSTTKQKGPKVTLMDGHVKQYYFARRGETSTHDTSLPPPVKVLSGRSIPLKEIPFEATR
NELVQIYLTSIDKLIKSNKLNSIPSQQIASHYLFLRSLANSETDGIKKNQILSLAKPLGTYLASKEPHVW
KMINELIEKSEYPIIHYLKNNRAHSNFMLALIHEYHKEPLTKNQSAFVQKFRDSSVFLFPNPIYTAWLAH
SYDEDSSFNPMFRERLSTNFYHSTLTDNLLLRTEPKEVTLSSEHHYKKEKGPIDSSFRYQMSSDRLLRIQ
GRTLLFSTPQNDVVAVKVQKKGEPKSTLEEEFEMADYLLKHQRRLDVHSKLPQPLGQYSVKKSEILEISR
GSLDFERFKTLIDDSKDLEVYVYKAPQSYFTYLHDKNQDLEDLTASVKTNVHDLFVLLREGIVFPQLADI
FHTHFGEDEREDKGRYQALVQLLNVLQFQLGRIDKWQKAVEYVNLRSSGLADLGDSLPITSLFTSSDFTK
HYFSELLTGGYHPTFFDKSSGTANSLFTGKRRLFGNYLYLNTIAEYLLVIQLTLGSYGDKVTRDMMDKPK
KEAVWRELANVMFTSCAEAIHIMTGIPQSRALTLLKQRANIEKHFRQTQFWMTPDYSKLDEDTLQMEQYS
IYSGEPEYEFTDKLVSGVGLSVDGVHQDLGGYNRESPLRELEKLLYATVTLIEGTMQLDKEFFKQLEQVE
KILSGEIKTDANSCFEAVAQLLDLARPGCHFQKRLVLSYYEEAKLKYPSAPTDAYDSRFQVVARTNAAIT
IQRFWREARKNLSEKSDIDSEKPESERTTDKRL

Molecule Role Virulence factor
Molecule Role Annotation MUTATION: sidJ (lpg2155) mutant is attenuated in macrophages (Liu and Luo, 2007).
References
Liu and Luo, 2007: Liu Y, Luo ZQ. The Legionella pneumophila effector SidJ is required for efficient recruitment of endoplasmic reticulum proteins to the bacterial phagosome. Infection and immunity. 2007; 75(2); 592-603. [PubMed: 17101649].