Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

enhC

Victor ID 1441
Gene Name enhC
Sequence Strain (Species/Organism) Legionella pneumophila subsp. pneumophila str. Philadelphia 1
NCBI Gene ID 3079177
NCBI Protein GI 52842845
Locus Tag lpg2639
Genbank Accession AE017354
Protein Accession YP_096644
Other Database IDs UniProtKB-ID: Q5ZS80_LEGPH
UniRef100: UniRef100_Q5ZS80
UniRef90: UniRef90_A5IAT7
UniRef50: UniRef50_D3HKW1
UniParc: UPI0000442A0E
EMBL: AE017354
EMBL-CDS: AAU28697.1
RefSeq_NT: NC_002942.5
GenomeReviews: AE017354_GR
KEGG: lpn:lpg2639
NMPDR: fig|272624.3.peg.2589
eggNOG: COG0790
HOGENOM: HBG520284
OMA: MYEYGKG
ProtClustDB: CLSK914570
BioCyc: LPNE272624:LPG2639-MONOMER
Taxonomy ID 272624
Gene Starting Position 2981817
Gene Ending Position 2985419
Gene Strand (Orientation) -
Protein Name enhanced entry protein EnhC
Protein pI 5.87
Protein Weight 129178.42
Protein Length 1200
DNA Sequence
>gi|52840256:2981817-2985419 Legionella pneumophila subsp. pneumophila str. Philadelphia 1 chromosome, complete genome
CTTAACCCAAGTTATTCATTAATTTGGCTTGATTCAACTGCTCATAAGCTCGCTTTGCAGGAATAAAATT
GGGATATTGCGTCACCAGACGTTGCAAGATCATTCTGGACAAAACCTCCTCCCCATGATTCCATTCATTT
AATGCATCAAAATAAATCATATCAGCGCTTTGGCCATCAAATTTGGGAACATTATTAAATAACACGGGCT
CGACATAACTTACTTTACCCTGGGTTTGTGCATCTAATCTTTGCAATACTCTACGGGCCTGTAAACTTCC
ATTTTCACTCGCTTGTTGTAATAGCTCACGGCCTTTTTCGGGTAGTCGTTCGCCTGCCGTTCCCTCAATA
TAATAAGTACCTAATTGATATTGAGCATAAGCATTTTGCTTTTGTGCCAATTTTTGATAAATACTCGCTG
ATCTTTTATGATCCTTTTCGACACCAAGACCATAATGATACATTCTTGCCAAAGCCAGCATTGCTTTTTC
ATTACCTTTATCAGATGCATCCTGGTAATACCGTAAAGCATCTGGAAAATCCAATTTAACACCAACACCA
GTTTCGGATAATAAACCGAGGGCATACAAGGCATTCCCATTACCTAAGCTTGCAGCCTTTTTATACCAGA
CCAAAGCTTGTTGTTCGTTTCTTGGTTGCCCCAAACCATAAAAATACATTCCAGCCAATTGACTCATCGC
TTCAGGAGCACCTTTCTCTGATGCTTCTTTAAACAAAGATAACGCTTTGGAGTAAGTGACGGGCACACCC
TTGCCATACTCATACATTAAAGCCAAATTATAAGCGCCTAACATATCTCCTTTTGCTGCTGCATTTTCAT
AGGCTTTTAGTGCTTGAGCATAATCATCATCTACCGTTTCATAAATAAAACCTAATGCTACATCGGCTTT
AGATAAATGTTTCGCTGCTTTTTGATACCAATATTTGGCTAAATTATAATCAGGCTCCCCTGTTTCACCT
AGTTGATAAAATTGACCTAATAAGTATTGTGCTTCAGGATTGCCTTGTTCTGCCGAAGCAGTATACCAAT
GTTGCGCGCCAGCAAGATCCGGTGCGGCACCCAATCCTTTTTGTAGCATATAAGCCAACTTTAATTGTGC
ATATTGATCGCCTTTATCAGCTAAGCCCTTATAAATTTCCTTAGCTTGATTCATTTGTTCAGGAGCACTG
CTTTGAGATAAATAATAATCTGCCAATACTATCCCCGCATGACTATTCCCTAATTTATAAGATTCAATTA
AATTGGGTAAAAAGTCTTCCCCTGATTGTTGCTTAAGTACTGCCAGATTAAAGTCGGCATAGGAAAATTG
GGAGTTTGCAGATTGCCTCAGCAAATCCAATCCTTTTTCCTTATCCTGTGCGACCCCTTTTCCTTCTGTT
ATGTAAGTACCCAATATAAACTGACTTACGGGATTTTGTCCGGCTTGTTGATACCAGTACATGGCCTTGG
CTGGATCAGCTGTTATGCCTATACCACGGTCATAGAGCATTCCCAGTAAAAGAGCAGCGTTCTCATTACC
TGTTTCAGCTTGCTCTTCAGCTACTTTAAATGCTTGTTCCTGCTTTTGCCTGTTATCATCCATCGCATTA
TAAAATGCCAATGGCAACAATGCCTCTGCCACTTTATTCTTCACAGCACCTTGGTATAACTTTCTTATTA
AGGCAATTTTTTGTTTTCTGACATCTACACTTAAACCATTGTTGTAGTCTCTTGCCAAATATTCTGCCAA
CTCATATTCTGCCGGACCATAATCATTGGCCGCTGAAAGATAAAGCATGGCCATAGCTTGCTCATCATTT
GCTTTAATATACTCTTTTCCATCAGGACCAACGATCCCCTGGCGCAATATCCGTGCCAATACATATTGTG
CTCTCTTATTCCCTTTGAATGCGGAATCAGTCAGCCAATTTAATGCTTGTTGGTAATCATTTTCGTCTTT
ACCGCGTTTCAGATAAAGTATTCCCAAATTATATTCAGCACCTAAGTGCTTTTGTTCTGCGGCATTCTCA
TAAAAAATAATAGCCGAAGCATCATCTTGCATTAAACCAATGCCATATTGAAACAATTGACCAATTTCAA
ATTGAGTTTGGGCATTTCCAAGTATTGCCCTGAAATACAAATAATTGACCACAGACATATAATTGACAGT
CCGCTTCCAATCTCCTGTCCAAATGTCCATCAAATCAAAACTGCCAACTTCGCTATCATCATAATTCGCG
TCGGTATAAGGAACTGGCAAGTTGAGCTTTTGTACAACAGGACTATTAGTCCTCTCTAGAGCTTCTACGA
ATGGGTTAAGTCTGTAAGTTGGATAAGCCCATTGATTTGATTGAAACTCTACTTGTTTACTGATTAAAGC
ATCATAGTAATTGCTTATAGGAATACTGTTAGGCTGAGTCAACTCAAATTGTGGTTTGAAAATATCCTGA
CGAGAGATGGTTTCAAGCTTAGGTGCTTGATTATAGCTATTATTTCTCAAGGCAGACGGATTATTCCATG
GGCTAAATATACCATTCATCTGGTAAGCCGTCTCTTCCAATTTATCCGTTCTGTCATTACTTAGCCATAA
TGCAGCTTGGGCAAGAAGAGGAGGCTCTGCATTTTTCTTCTCATTTTCTGCTGCTTTAAGAGTCCATTGT
TTAGACAATTCCTCATCAGCCGCTACGCCAATCCCTTTTTGATATAAATTGGCTAATTCTTTTTGAGCTT
GAACCGAACCATTCTGGGCTGCTTTTAGTACAAATAAAAAACCTGTTTTTGGATCATAAACTGGACTTTT
ATCTTGTAAATAAATATGGGCTAACTCAAGAGTAGCTTCTGTACTTTGTTTCGCGGCCTTATTAAGCCAT
TGAATAGCCTCATCGTATTGATTTTGCATTAAAGCCAACTTACCCAACTCAAGCATGGCTGGAGCATATT
GTTCTGACGCTGCTTTATTTAATAATTCAACACCTTTGGCAGTATCTTTGGTAACCATTTGTCCGGCCAC
ATAAAATCTGCCCAATTCTGTTAAAGCTTTTGGATCTCCATTTTCTGCTGCTTTATTCAGCCAAATGATC
CCTAATTTTTTATTACCCGCATGCTTACTCTCTAAGAAATACTTTGCTAAGGTGTATTGAGCAATAGGAT
TACCATTTTTTGCTGCATCAATATAATAACGTCTCGCGATATCTGTATTTTTCTTGACGCCAACACCATA
TAAATAAGCTGCCGCCATAAACATTTGTGCGCTCATATCTCCCACTGCGGCTGCCTGCTTAAACCAACGA
GCAGCTTCTTCCGGATTTTTTTCATGGAGCAAACTGTATTTGGCCATGAGCAGGACAGCAGGTAAATATC
CTTTTTCCGCTGATTTGGTAAAGTAGCGCATCGCAACACGATTGTTTTTTAACTGCCCATATCCATAGAG
ATAAAGTCGCCCTAAATAGTATTCGGCAACAGCATCCTGACCTGATTTAATGATTAGGGGCTCAGCTGCT
TCATTATAATTGCCTAATCTATAAGCATTGAACGCCTCATTGGCAAAAGCCTGTTGGCCAGCTGACGCGA
CTAAAACACACACCCAAGGTACTAGTGATTTCA

Protein Sequence
>gi|52842845|ref|YP_096644.1| enhanced entry protein EnhC [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
MKSLVPWVCVLVASAGQQAFANEAFNAYRLGNYNEAAEPLIIKSGQDAVAEYYLGRLYLYGYGQLKNNRV
AMRYFTKSAEKGYLPAVLLMAKYSLLHEKNPEEAARWFKQAAAVGDMSAQMFMAAAYLYGVGVKKNTDIA
RRYYIDAAKNGNPIAQYTLAKYFLESKHAGNKKLGIIWLNKAAENGDPKALTELGRFYVAGQMVTKDTAK
GVELLNKAASEQYAPAMLELGKLALMQNQYDEAIQWLNKAAKQSTEATLELAHIYLQDKSPVYDPKTGFL
FVLKAAQNGSVQAQKELANLYQKGIGVAADEELSKQWTLKAAENEKKNAEPPLLAQAALWLSNDRTDKLE
ETAYQMNGIFSPWNNPSALRNNSYNQAPKLETISRQDIFKPQFELTQPNSIPISNYYDALISKQVEFQSN
QWAYPTYRLNPFVEALERTNSPVVQKLNLPVPYTDANYDDSEVGSFDLMDIWTGDWKRTVNYMSVVNYLY
FRAILGNAQTQFEIGQLFQYGIGLMQDDASAIIFYENAAEQKHLGAEYNLGILYLKRGKDENDYQQALNW
LTDSAFKGNKRAQYVLARILRQGIVGPDGKEYIKANDEQAMAMLYLSAANDYGPAEYELAEYLARDYNNG
LSVDVRKQKIALIRKLYQGAVKNKVAEALLPLAFYNAMDDNRQKQEQAFKVAEEQAETGNENAALLLGML
YDRGIGITADPAKAMYWYQQAGQNPVSQFILGTYITEGKGVAQDKEKGLDLLRQSANSQFSYADFNLAVL
KQQSGEDFLPNLIESYKLGNSHAGIVLADYYLSQSSAPEQMNQAKEIYKGLADKGDQYAQLKLAYMLQKG
LGAAPDLAGAQHWYTASAEQGNPEAQYLLGQFYQLGETGEPDYNLAKYWYQKAAKHLSKADVALGFIYET
VDDDYAQALKAYENAAAKGDMLGAYNLALMYEYGKGVPVTYSKALSLFKEASEKGAPEAMSQLAGMYFYG
LGQPRNEQQALVWYKKAASLGNGNALYALGLLSETGVGVKLDFPDALRYYQDASDKGNEKAMLALARMYH
YGLGVEKDHKRSASIYQKLAQKQNAYAQYQLGTYYIEGTAGERLPEKGRELLQQASENGSLQARRVLQRL
DAQTQGKVSYVEPVLFNNVPKFDGQSADMIYFDALNEWNHGEEVLSRMILQRLVTQYPNFIPAKRAYEQL
NQAKLMNNLG

Molecule Role Virulence factor
Molecule Role Annotation MUTATION: enhC mutant is attenuated in mouse macrophages (Liu et al., 2008).
COG COG0790R, under R: General function prediction only
References
Liu et al., 2008: Liu M, Conover GM, Isberg RR. Legionella pneumophila EnhC is required for efficient replication in tumour necrosis factor alpha-stimulated macrophages. Cellular microbiology. 2008; 10(9); 1906-1923. [PubMed: 18549456].