Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

lpg2515

Victor ID 1450
Gene Name lpg2515
Sequence Strain (Species/Organism) Legionella pneumophila subsp. pneumophila str. Philadelphia 1
NCBI Gene ID 3080592
NCBI Protein GI 52842723
Locus Tag lpg2515
Genbank Accession AE017354
Protein Accession YP_096522
Other Database IDs UniProtKB-ID: Q5ZSK2_LEGPH
UniRef100: UniRef100_Q5ZSK2
UniRef90: UniRef90_Q5ZSK2
UniRef50: UniRef50_Q5ZSK2
UniParc: UPI00000B524B
EMBL: AE017354
EMBL-CDS: AAU28575.1
RefSeq_NT: NC_002942.5
GenomeReviews: AE017354_GR
KEGG: lpn:lpg2515
NMPDR: fig|272624.3.peg.2467
eggNOG: COG3323
HOGENOM: HBG340986
OMA: SHPYETP
ProtClustDB: CLSK833450
BioCyc: LPNE272624:LPG2515-MONOMER
Taxonomy ID 272624
Gene Starting Position 2843495
Gene Ending Position 2843860
Gene Strand (Orientation) -
Protein Name structural toxin protein (hemagglutinin/hemolysin) RtxA
Protein pI 5.58
Protein Weight 12423.29
Protein Length 121
DNA Sequence
>gi|52840256:2843495-2843860 Legionella pneumophila subsp. pneumophila str. Philadelphia 1 chromosome, complete genome
TTTAGAACTCTGTCTCAATACGTACCACTTGATAAGAAGGGCTTTCATAGGGATGAGCTTTTTTTAAAGC
TGCAACCACCTCTTTGATTCTCTCTCTGGCGCAAATCGTTTCCACCTTGTATTCAGGCACTTTTTCCAAT
TGATTAATTTCTCCAATAAACGCCTGGCTACCTGGTAAAGGCATAAACTGGCCTTCACCTAAAGTTTGCC
AGGCGCAATGGTTATAATTATCAACATAACCAGCCCCTGCCGCAAAAACTGCATTTTTTACTTCGTCAAG
ATGAGTTTCTGGAACATGAAAATACAACATATACATGATAGCTATACCTCCCTTGATATTTATTACCACA
CAAGATAGAAATGCCA

Protein Sequence
>gi|52842723|ref|YP_096522.1| structural toxin protein (hemagglutinin/hemolysin) RtxA [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
MAFLSCVVINIKGGIAIMYMLYFHVPETHLDEVKNAVFAAGAGYVDNYNHCAWQTLGEGQFMPLPGSQAF
IGEINQLEKVPEYKVETICARERIKEVVAALKKAHPYESPSYQVVRIETEF

Molecule Role Virulence factor
Molecule Role Annotation MUTATION: rtxA mutant is attenuated in mice and does not replicate as well as the wild type in monocytes (Cirillo et al., 2001).
COG COG3323S, under S: Function unknown
References
Cirillo et al., 2001: Cirillo SL, Bermudez LE, El-Etr SH, Duhamel GE, Cirillo JD. Legionella pneumophila entry gene rtxA is involved in virulence. Infection and immunity. 2001; 69(1); 508-517. [PubMed: 11119544].