Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

djlA from Legionella pneumophila str. Lens

Victor ID 1455
Gene Name djlA from Legionella pneumophila str. Lens
Sequence Strain (Species/Organism) Legionella pneumophila str. Lens
NCBI Gene ID 3113813
NCBI Protein GI 54295182
Locus Tag lpl2262
Protein Accession YP_127597.1
Other Database IDs UniProtKB-ID: Q5WUA6_LEGPL
UniRef100: UniRef100_Q5WUA6
UniRef90: UniRef90_Q9X772
UniRef50: UniRef50_Q9X772
UniParc: UPI0000445B00
EMBL: CR628337
EMBL-CDS: CAH16502.1
RefSeq_NT: NC_006369.1
GenomeReviews: CR628337_GR
KEGG: lpf:lpl2262
NMPDR: fig|297245.3.peg.1575
LegioList: lpl2262
eggNOG: COG1076
HOGENOM: HBG508481
OMA: LRACWRM
ProtClustDB: PRK09430
BioCyc: LPNE297245:LPL2262-MONOMER
Taxonomy ID 297245
Gene Starting Position 2579550
Gene Ending Position 2580440
Gene Strand (Orientation) +
Protein Name Dna-J like membrane chaperone protein
DNA Sequence
>gi|54292964:2579550-2580440 Legionella pneumophila str. Lens, complete genome
AATGAACTTACGCGATTTCTTTATAATAACAACCTGGTGGGGAAAAATACTTGGTGCCTTCTTTGGCTAC
TTAACTGCTGGGCCAGTAGGCGCTTTGTTTGGCATTCTCGTTGGAAACTTTTTTGATCGGGGCCTTGTCA
GTTATTACTCCAATCCCCATTGGCTGTACCATGCAGAAAAACAAAGAATCGTCCAAAAAGCTTTCTTTGA
AGCCACTTTCTCCATAATGGGGCATGTTGCGAAATCGGATGGCCGTGTTTCTGAACAAGAGATTAGCATG
GCTAAATCCATCATGAATGAAATGAAATTGAGCAAGGAGCAAAAGGATTTGGCAAAAAGATTATTTAATG
AAGGGAAACAACCTGATTTCAATGTCAGTCTTGCTCTTATCCAATTACAAAGAATCTGCAAGGATAACCG
TGATTTGTTAAAGCTTTTTGTAGATATTCAGTATAGGGCAGCTCAAGTAGATGGATTAAGTAGCCAAAAA
ATTCACGCACTAGATAACATTTTTACGCATCTGGGATTTGCTCCCCTACACAAACAGTATCGTTTTTATG
AGGATTTTGGTTCTTATTTCCAGCAAGAACAATCCAAACAACACTATCATAATCAACAGGAGTACAAGCA
TACTTCCTCATCTCATGGTCAACAGGGTTACAAACCTCAATCACCCCCTAATACTTTAGCTCATGCTTTT
GCATTACTTGAGGTAAGTCCGAATGCAAACAAACAGGAGGTTAGAAGAGCGTACAGACGTCTATTGAGCC
GTAACCATCCAGATAAATTAATTGCTCAAGGTTTCCCCGAAGAAATGATTAAATTGGCTAACGATAAAAC
TCATCAAATTATGAAAGCCTATGAATTGATCTGTGAAACCAAGGGTTGGTA
Protein Sequence
>gi|54295182|ref|YP_127597.1| Dna-J like membrane chaperone protein [Legionella pneumophila str. Lens] MNLRDFFIITTWWGKILGAFFGYLTAGPVGALFGILVGNFFDRGLVSYYSNPHWLYHAEKQRIVQKAFFEATFSIMGHVAKSDGRVSEQEISMAKSIMNEMKLSKEQKDLAKRLFNEGKQPDFNVSLALIQLQRICKDNRDLLKLFVDIQYRAAQVDGLSSQKIHALDNIFTHLGFAPLHKQYRFYEDFGSYFQQEQSKQHYHNQQEYKHTSSSHGQQGYKPQSPPNTLAHAFALLEVSPNANKQEVRRAYRRLLSRNHPDKLIAQGFPEEMIKLANDKTHQIMKAYELICETKGW
Molecule Role Virulence factor
Molecule Role Annotation MUTATION: djlA mutant is attenuated in mouse macrophages (Vincent et al., 2006).
COG COG1076O, under O: Posttranslational modification, protein turnover, chaperones
References
Vincent et al., 2006: Vincent CD, Buscher BA, Friedman JR, Williams LA, Bardill P, Vogel JP. Identification of non-dot/icm suppressors of the Legionella pneumophila DeltadotL lethality phenotype. Journal of bacteriology. 2006; 188(23); 8231-8243. [PubMed: 16997951].