Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

icmX from Legionella pneumophila str. Lens

Victor ID 1456
Gene Name icmX from Legionella pneumophila str. Lens
Sequence Strain (Species/Organism) Legionella pneumophila str. Lens
NCBI Gene ID 3114023
NCBI Protein GI 54295529
Locus Tag lpl2616
Protein Accession YP_127944.1
Other Database IDs UniProtKB-ID: Q5WTA9_LEGPL
UniRef100: UniRef100_Q5WTA9
UniRef90: UniRef90_Q5WTA9
UniRef50: UniRef50_Q5X1K0
UniParc: UPI0000445C3D
EMBL: CR628337
EMBL-CDS: CAH16857.1
RefSeq_NT: NC_006369.1
GenomeReviews: CR628337_GR
KEGG: lpf:lpl2616
NMPDR: fig|297245.3.peg.1455
LegioList: lpl2616
HOGENOM: HBG520266
OMA: QINDASP
ProtClustDB: CLSK833558
BioCyc: LPNE297245:LPL2616-MONOMER
Taxonomy ID 297245
Gene Starting Position 2985372
Gene Ending Position 2986784
Gene Strand (Orientation) +
Protein Name Intracellular multiplication protein IcmX
DNA Sequence
>gi|54292964:2985372-2986784 Legionella pneumophila str. Lens, complete genome
AATGAAAGTATTACCTAAACTGGCCTTGGCCAATCTGTTTTGTTTTACCACCTTATCTGTTTTCGCTCAA
GGACAAGGATATGATCCATCGTACCAGCAGACAAGCACCAATACGTCCAACCTGGTAACTTACCTTACCA
ATCTGGGAAAATATTTAGGCTATGACATCACTCAATCCAATAAAACGCCTAACCCGCCTTATTCACAATT
ATTCAATTCCAATGTAGCCCAACTCATTCAAAGTTACGCTTACAATACCTTTTTAGGCGCTATTCCTGTC
GATGCCATGTCACAGAGCTTAATGAATTTCGTCACCAATAATGTGCAAGGAAATGCCTTAATAAATAACT
TGGCAAACAGCACCTTTAAATATCAAAATTTCAGCTCCCCATCCTCCGGTGCGAATGGGAAAATTACAGC
TAACGGTATAATAGACCAATCAACAACCACTGCCCAAGCACCCACTCCCACAGGGATTTTTTCAGCTCCA
CAAGGCCCAACTGCCGGAACTTATTTGAATGATCCGGTCAGTCAGGCCGTATTCAATATTCTGGGAACAC
CGGATTACAGTTTTTGTATGGACAATGATCAAAAGAACTGGGTGCCCAATTGTAACCTCATGTATCAAAA
TCTGGTCATGCAAAATGTAATTGGCACTTTGCCTCCAGCCTTGCCTAATCAAAGCTCGCTGGAACCTTTT
TATAGCTACACGTACAATAAACCGCTCATAAGCCAACTGAACAGTAACTCTTTGATTGCGCCATTACTCC
TGGATACCTCTGCGACACAATCAGAGCAACAATCCGGATTAAAAGCACAAAGCCAAGCCCAGCAAGCGCT
TAATTTTATTAGATACGCCAGCGCTCAAGTCACTCCTCCTTCCTTGCCCAAGTTGAGCGCCTACACTGAG
TTATGGAATCAGGCTAAGGCTGAACCAGGTTCCCAAGGTTATAATGAAGTCCAGCAAAAACAAGCGGCCG
CAACATTAAGCGGTTATTTTAATAATTTGCGTGTTTATGCAGCGCAAACTTCTGTGGGCGTAAGTAACCT
CTACTATATTTTATCCAAACGGCTACCCCAAAATATGAGTGGAGATCAAAATAGTTCCAATATCACCAGC
CAGGCTTTGAATGAATTTAACATGGCAACTCGACGATTATTTGATCCAACCGCCTCCAACACTCCGGGAC
AACCAAACCAACAATGGATTAAACAAATTAATGACGCATCCCCTGCCACAGTTCAAAAAGAAATAGCGGT
ATTGCTGGCTGAAATTAATTATCAAATGTATTTGGACAGACAAATACAAGAACGGATATTGTTAACCAAC
AGCATTATGCTATTGCAAAACTTAAAAGCAGCCCAACCGACCGCAGATTTTTCAAACCAAAGCTCTCCCT
CTGAGCAACAATA
Protein Sequence
>gi|54295529|ref|YP_127944.1| intracellular multiplication protein IcmX [Legionella pneumophila str. Lens] MKVLPKLALANLFCFTTLSVFAQGQGYDPSYQQTSTNTSNLVTYLTNLGKYLGYDITQSNKTPNPPYSQLFNSNVAQLIQSYAYNTFLGAIPVDAMSQSLMNFVTNNVQGNALINNLANSTFKYQNFSSPSSGANGKITANGIIDQSTTTAQAPTPTGIFSAPQGPTAGTYLNDPVSQAVFNILGTPDYSFCMDNDQKNWVPNCNLMYQNLVMQNVIGTLPPALPNQSSLEPFYSYTYNKPLISQLNSNSLIAPLLLDTSATQSEQQSGLKAQSQAQQALNFIRYASAQVTPPSLPKLSAYTELWNQAKAEPGSQGYNEVQQKQAAATLSGYFNNLRVYAAQTSVGVSNLYYILSKRLPQNMSGDQNSSNITSQALNEFNMATRRLFDPTASNTPGQPNQQWIKQINDASPATVQKEIAVLLAEINYQMYLDRQIQERILLTNSIMLLQNLKAAQPTADFSNQSSPSEQQ
Molecule Role Virulence factor
Molecule Role Annotation MUTATION: icmX mutant is attenuated in guinea pigs (Edelstein et al., 1999).
References
Edelstein et al., 1999: Edelstein PH, Edelstein MA, Higa F, Falkow S. Discovery of virulence genes of Legionella pneumophila by using signature tagged mutagenesis in a guinea pig pneumonia model. Proceedings of the National Academy of Sciences of the United States of America. 1999; 96(14); 8190-8195. [PubMed: 10393970].