Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

rtxA-2

Victor ID 1457
Gene Name rtxA-2
Sequence Strain (Species/Organism) Legionella pneumophila str. Lens
NCBI Gene ID 3114223
NCBI Protein GI 54293628
Locus Tag lpl0681
Genbank Accession CR628337
Protein Accession YP_126043
Other Database IDs UniProtKB-ID: Q5WYQ5_LEGPL
UniRef100: UniRef100_Q5WYQ5
UniRef90: UniRef90_Q5WYQ5
UniRef50: UniRef50_Q5WYQ5
UniParc: UPI0000445E02
EMBL: CR628337
EMBL-CDS: CAH14915.1
RefSeq_NT: NC_006369.1
GenomeReviews: CR628337_GR
KEGG: lpf:lpl0681
NMPDR: fig|297245.3.peg.64
LegioList: lpl0681
eggNOG: COG2931
HOGENOM: HBG520014
OMA: FTITIDE
ProtClustDB: CLSK834505
BioCyc: LPNE297245:LPL0681-MONOMER
Taxonomy ID 297245
Gene Starting Position 739007
Gene Ending Position 762819
Gene Strand (Orientation) +
Protein Name structural toxin protein RtxA
Protein pI 3.52
Protein Weight 723609.908
Protein Length 7919
DNA Sequence
>gi|54292964:739007-762819 Legionella pneumophila str. Lens, complete genome
TTTGAGGACAGAACATGTTAGCTGAATCTGTTATCGGTATAGTAAGAGCCGTCAATGGACTGCTAGAAAA
AGTAAACGCACAAGGACAAGCCAGCATAGTCAAGTCAGGTGCTCGATTACAGGAAGGGGATGTACTTACC
CTATTAAGTGGGGAAGCCTATATACAATTTATTCATGGATTTCCAGAGGCACTAGCTTTAGGAAAACCAG
TCAATTTGTATGGTGTTTCACCGATATTGCAATATGGAGTGGAAGAACTCAATGAGCAACTGGTCCAGGA
AGCGATAGCCAAAGGGATTGATCCTTCGATTATTCTTGATGTTCTGGGTTCAGCAGCAGCTGGTGCAGAA
GCCGTAGGCTCAGGCGGAGATGCTTTTATTATTGATCCTTTGTTTGGTTTCGGACAGGTCACAGCAGGTT
ATCCTACCGGTCCTATTTCCTTTGCTTATGAGGCAGATACTCAGCACCTATTTTGGTATGTGCCAGAAGA
AACAGGAGTGATTGCAGAATCCGAATTGGCTAGCGAACCTGAATCTATCCCGCAAGTTCCTCAATTCACC
TCGAATCAAGCCACCATAACAGTATTTGAAGATGCCCTCCCAAGTGGTGGTATTAGAGATTCAGTAGAAC
AAACTACAACTGCGAGAGCATCTTTGAGCCCTTTAATTTCCTCTTCCTCAGAAGTTGCTGCTTCCTTTGC
TTTTAATACCAATTTAAGTGTACTTCCTAAATTACAGTCAGGTGGTTTAGAACTTGAATACATTCTATCT
AGTGACCATCTAGCCCTATCAGCAACAACTCCTGATGGTGCGGATGTTGTACGATTTGAGTTGACAGCAG
ATGGACAATTAACTCAAATATTAATCGGATCGATTGATCACCCAAGAGCTGATAGTGATGACAGCGAATG
GCATAGATTAGATCTCTCACCTGTAATCGATGTTACTTTCACAAGGATAAGCGATGGTACTTTTTTAGGC
TCAAGAACACTACCAGCTAGTGCTGCGATGGCAGAAATTCAAGACGATGTTCCAATAGCAAGGGTTCAAT
TAACAAATAATGAAATCCTGCTGGATGAAACAGTAGGAATAAAATTCGGTGATGCAGATGCGGCTAATGA
TGATTTTAATCCAACGACCACTGCGGATCCTTTTAATAATACTTATGGTAGACCCATTGGTTTGGTGCAA
AATGCGAATCTCCTTGATACCAGTACTTCTGAAATGGGGGGGGATTATAAAAATGCAACAATGACCCATT
TGTTAAAAATTACCGATGCTGTTTCAGGATTACAGACATCTGACGGCACTCCTATCAATCTCTTTTTGGA
ATCGAATGGTGATATTACGGGGCGAGCAGGAGATATTGGTGCTCCTGCAGTTTTTGCAATTCGCATGAAT
CCAAATACCGGCTCAATTACTGTTGCGCAATATGGTTCAATCAAACAATTTGATACCAACAGCCATGATG
AAGCGGTTGATTTGACAGGTCGCATTTCAGCTGTCGTTACAGTCAAAGACAGTGATGGCGATGTATCTAA
TGTAGAAATACCGATAGGACAACAGATTATTTTTGAAGACGACGGCCCGAGCATTGACGGCAGCAAGGTG
CTGTCTGCCGATGTGTTGACGGTGGATGAAACGAATTTGGGCGCTAACGCGACGGCCAGTTTTGCTGATA
ACTTTGCCCAGGCCATTGATTTTGGTGAAGACGGGGCAGGCTCTGTGACCTATGCCCTGGTATTGAATGG
CAGCAACGTGGGCTCAGGGCTGTATGCCATTGATAACCTGGATGTGAGTACAGCAGACGGTGACGGCATT
GGGCGGGGCGGTGAGATTGTATTAAACCAAAACGGCAATGTGGTGACCGGCAGCCTGGGCGGCGTGGATT
ATTTTACGATTACCATTGATGAGGCGAGCGGTGAGGTGGTGTTTGAGCAGCTGGCTTCGGTATGGCATGC
CAATACGGCGAACCCCGACGACCAGTCCGCTTTACAGGCTCTGGCCAACAGTTTGGTGGTTCGGGCCACG
GTAGTGGATGCCGACGGCGATCAGGCTGTCCATGATTTGGATGTGAGCCAGGGCGTGTTCCAGGTGAAAG
ACGACGGCCCGAGCATTGACGGCAGCAAGGTGCTGTCTGCCGATGTGCTGACGGTGGATGAAACGAATTT
GGGCGCTAACGCGACGGCCAGTTTTGCTGATAATTTTGCCCAGGCCATTGATTTTGGTGAAGACGGGGCA
GGCTCTGTGACCTATGCCCTGGTATTGAATGGCAGCAACGTGGGCTCAGGGCTGTATGCCATTGATAACC
TGGATGTGAGCACAGCAGACGGTGACGGCATCGGGCGGGGCGGTGAGATTGTATTAAACCAAAACGGCAA
TGTGGTGACCGGCAGCCTGGGCGGCGTGGATTATTTTACGATTACCATTGATGAGGCGAGCGGTGAGGTG
GTGTTTGACCAGCTGGCTTCGGTATGGCATGGCAATACGGCGAACCCCGACGACCAGTCCGCTTTACAGG
CTCTGGCCAACAGTTTGGTGGTTCGGGCCACGGTAGTGGATGCCGACGGCGATCAGGCTGTCCATGATTT
GGATGTGAGCCAGGGCGTGTTCCAGGTGAAAGACGACGGCCCGAGCATTGACGGCAGCAAGGTGCTGTCT
GCCGATGTGCTGACGGTGGATGAAACGAATTTGGGCGCTAACGCGACGGCCAGTTTTGCTGATAATTTTG
CCCAGGCCATTGATTTTGGTGAAGACGGGGCAGGCTCTGTGACCTATGCCCTGGTATTGAATGGCAGCAA
CGTGGGCTCAGGGCTGTATGCCATTGATAACCTGGATGTGAGCACAGCAGACGGTGACGGCATCGGGCGG
GGCGGTGAGATTGTATTAAACCAAAACGGCAATGTGGTGACCGGCAGCCTGGGCGGCGTGGATTATTTTA
CGATTACCATTGATGAGGCGAGCGGTGAGGTGGTGTTTGAGCAGCTGGCTTCGGTATGGCATGCCAATAC
GGCGAACCCCGACGACCAGTCCGCTTTACAGGCTCTGGCCAACAGTTTGGTGGTTCGGGCCACGGTAGTG
GATGCCGACGGCGATCAGGCTGTCCATGATTTGGATGTGAGCCAGGGCGTGTTCCAGGTGAAAGACGACA
GCCCGAGCATTGACGGCAGCAAGGTGCTGTCTGCCGATGTGCTGACGGTGGATGAAACGAATTTGGGCGC
TAACGCGACGGCCAGTTTTGCTGATAATTTTGCCCAGGCCATTGATTTTGGTGAAGACGGGGCAGGCTCT
GTGACCTATGCCCTGGTATTGAATGGCAGCAACGTGGGCTCAGGGCTGTATGCCATTGATAACCTGGATG
TGAGCACAGCAGACGGTGACGGCATCGGGCGGGGCGGTGAGATTGTATTAAACCAAAACGGCAATGTGGT
GACCGGCAGCCTGGGCGGCGTGGATTATTTTACGATTACCATTGATGAGGCGAGCGGTGAGGTGGTGTTT
GAGCAGCTGGCTTCGGTATGGCATGCCAATACGGCGAACCCCGACGACCAGTCCGCTTTACAGGCTCTGG
CCAACAGTTTGGTGGTTCGGGCCACGGTAGTGGATGCCGACGGCGATCAGGCTGTCCATGATTTGGATGT
GAGCCAGGGCGTGTTCCAGGTGAAAGACGACGGCCCGAGCATTGACGGCAGCAAGGTGCTGTCTGCCGAT
GTGCTGACGGTGGATGAAACGAATTTGGGCGCTAACGCGACGGCCAGTTTTGCTGATAATTTTGCCCAGG
CCATTGATTTTGGTGAAGACGGGGCAGGCTCTGTGACCTATGCCCTGGTATTGAATGGCAGCAACGTGGG
CTCAGGGCTGTATGCCATTGATAACCTGGATGTGAGTACAGCAGACGGTGACGGCATTGGGCGGGGCGGT
GAGATTGTATTAAACCAAAACGGCAATGTGGTGACCGGCAGCCTGGGCGGCGTGGATTATTTTACGATTA
CCATTGATGAGGCGAGCGGTGAGGTGGTGTTTGAGCAGCTGGCTTCGGTATGGCATGCCAATACGGCGAA
CCCCGACGACCAGTCCGCTTTACAGGCTCTGGCCAACAGTTTGGTGGTTCGGGCCACGGTAGTGGATGCC
GACGGCGATCAGGCTGTCCATGATTTGGATGTGAGCCAGGGCGTGTTCCAGGTGAAAGACGACGGCCCGA
GCATTGACGGCAGCAAGGTGCTGTCTGCCGATGTGCTGACGGTGGATGAAACGAATTTGGGCGCTAACGC
GACGGCCAGTTTTGCTGATAATTTTGCCCAGGCCATTGATTTTGGTGAAGACGGGGCAGGCTCTGTGACC
TATGCCCTGGTATTGAATGGCAGCAACGTGGGCTCAGGGCTGTATGCCATTGATAACCTGGATGTGAGTA
CAGCAGACGGTGACGGCATTGGGCGGGGCGGTGAGATTGTATTAAACCAAAACGGCAATGTGGTGACCGG
CAGCCTGGGCGGCGTGGATTATTTTACGATTACCATTGATGAGGCGAGCGGTGAGGTGGTGTTTGAGCAG
CTGGCTTCGGTATGGCATGCCAATACGGCGAACCCCGACGACCAGTCCGCTTTACAGGCTCTGGCCAACA
GTTTGGTGGTTCGGGCCACGGTAGTGGATGCCGACGGCGATCAGGCTGTCCATGATTTGGATGTGAGCCA
GGGCGTGTTCCAGGTGAAAGACGACGGCCCGAGCATTGACGGCAGCAAGGTGCTGTCTGCCGATGTGCTG
ACGGTGGATGAAACGAATTTGGGCGCTAACGCGACGGCCAGTTTTGCTGATAATTTTGCCCAGGCCATTG
ATTTTGGTGAAGACGGGGCAGGCTCTGTGACCTATGCCCTGGTATTGAATGGCAGCAACGTGGGCTCAGG
GCTGTATGCCATTGATAACCTGGATGTGAGCACAGCAGACGGTGACGGCATCGGGCGGGGCGGTGAGATT
GTATTAAACCAAAACGGCAATGTGGTGACCGGCAGCCTGGGCGGCGTGGATTATTTTACGATTACCATTG
ATGAGGCGAGCGGTGAGGTGGTGTTTGACCAGCTGGCTTCGGTATGGCATGGCAATACGGCGAACCCCGA
CGACCAGTCCGCTTTACAGGCTCTGGCCAACAGTTTGGTGGTTCGGGCCACGGTAGTGGATGCCGACGGC
GATCAGGCTGTCCATGATTTGGATGTGAGCCAGGGCGTGTTCCAGGTGAAAGACGACGGCCCGAGCATTG
ACGGCAGCAAGGTGCTGTCTGCCGATGTGCTGACGGTGGATGAAACGAATTTGGGCGTCAATGCGACGGC
CAGTTTTGCTGATAATTTTGCCCAGGCCATTGATTTTGGTGAAGACGGGGCAGGCTCTGTGACCTATGCC
CTGGTATTGAATGGCAGCAACGTGGGCTCAGGGCTGTATGCCATTGATAACCTGGATGTGAGCACAGCAG
ACGGTGACGGCATCGGGCGGGGCGGTGAGATTGTATTAAACCAAAACGGCAATGTGGTGACCGGCAGCCT
GGGCGGCGTGGATTATTTTACGATTACCATTGATGAGGCGAGCGGTGAGGTGGTGTTTGAGCAGCTGGCT
TCGGTATGGCATGCCAATACGGCGAACCCCGACGACCAGTCCGCTTTACAGGCTCTGGCCAACAGTTTGG
TGGTTCGGGCCACGGTAGTGGATGCCGACGGCGATCAGGCTGTCCATGATTTGGATGTGAGCCAGGGCGT
GTTCCAGGTGAAAGACGACGGCCCGAGCATTGACGGCAGCAAGGTGCTGTCTGCCGATGTGCTGACGGTG
GATGAAACGAATTTGGGCGCTAACGCGACGGCCAGTTTTGCTGATAATTTTGCCCAGGCCATTGATTTTG
GTGAAGACGGGGCAGGCTCTGTGACCTATGCCCTGGTATTGAATGGCAGCAACGTGGGCTCAGGGCTGTA
TGCCATTGATAACCTGGATGTGAGCACAGCAGACGGTGACGGCATCGGGCGGGGCGGTGAGATTGTATTA
AACCAAAACGGCAATGTGGTGACCGGCAGCCTGGGCGGCGTGGATTATTTTACGATTACCATTGATGAGG
CGAGCGGTGAGGTGGTGTTTGACCAGCTGGCTTCGGTATGGCATGGCAATACGGCGAACCCCGACGACCA
GTCCGCTTTACAGGCTCTGGCCAACAGTTTGGTGGTTCGGGCCACGGTAGTGGATGCCGACGGCGATCAG
GCTGTCCATGATTTGGATGTGAGCCAGGGCGTGTTCCAGGTGAAAGACGANGGCCCGAGCATTGACGGCA
GCAAGGTGCTGTCTGCCGATGTGNTGACGGTGGATGAAACGAATTTGGGCGNNAANGCGACGGCCAGTTT
TGCTGATAANTTTGCCCAGGCCATTGATTTTGGTGAAGACGGGGCAGGCTCTGTGACCTATGCCCTGGTA
TTGAATGGCAGCAACGTGGGCTCAGGGCTGTATGCCATTGATAACCTGGATGTGAGNACAGCAGACGGTG
ACGGCATNGGGCGGGGCGGTGAGATTGTATTAAACCAAAACGGCAATGTGGTGACCGGCAGCCTGGGCGG
CGTGGATTATTTTACGATTACCATTGATGAGGCGAGCGGTGAGGTGGTGTTTGANCAGCTGGCTTCGGTA
TGGCATGNCAATACGGCGAACCCCGACGACCAGTCCGCTTTACAGGCTCTGGCCAACAGTTTGGTGGTTC
GGGCCACGGTAGTGGATGCCGACGGNGATCAGGCTGTCCATGATTTGGATGTGAGCCAGGGCGTGTTCCA
GGTGAAAGACGANGGCCCGAGCATTGACGGCAGCAAGGTGCTGTCTGCCGATGTGNTGACGGTGGATGAA
ACGAATTTGGGCGNNAANGCGACGGCCAGTTTTGCTGATAANTTTGCCCAGGCCATTGATTTTGGTGAAG
ACGGGGCAGGCTCTGTGACCTATGCCCTGGTATTGAATGGCAGCAACGTGGGCTCAGGGCTGTATGCCAT
TGATAACCTGGATGTGAGNACAGCAGACGGTGACGGCATNGGGCGGGGCGGTGAGATTGTATTAAACCAA
AACGGCAATGTGGTGACCGGCAGCCTGGGCGGCGTGGATTATTTTACGATTACCATTGATGAGGCGAGCG
GTGAGGTGGTGTTTGANCAGCTGGCTTCGGTATGGCATGNCAATACGGCGAACCCCGACGACCAGTCCGC
TTTACAGGCTCTGGCCAACAGTTTGGTGGTTCGGGCCACGGTAGTGGATGCCGACGGNGATCAGGCTGTC
CATGATTTGGATGTGAGCCAGGGCGTGTTCCAGGTGAAAGACGANGGCCCGAGCATTGACGGCAGCAAGG
TGCTGTCTGCCGATGTGNTGACGGTGGATGAAACGAATTTGGGCGNNAANGCGACGGCCAGTTTTGCTGA
TAANTTTGCCCAGGCCATTGATTTTGGTGAAGACGGGGCAGGCTCTGTGACCTATGCCCTGGTATTGAAT
GGCAGCAACGTGGGCTCAGGGCTGTATGCCATTGATAACCTGGATGTGAGNACAGCAGACGGTGACGGCA
TNGGGCGGGGCGGTGAGATTGTATTAAACCAAAACGGCAATGTGGTGACCGGCAGCCTGGGCGGCGTGGA
TTATTTTACGATTACCATTGATGAGGCGAGCGGTGAGGTGGTGTTTGANCAGCTGGCTTCGGTATGGCAT
GNCAATACGGCGAACCCCGACGACCAGTCCGCTTTACAGGCTCTGGCCAACAGTTTGGTGGTTCGGGCCA
CGGTAGTGGATGCCGACGGNGATCAGGCTGTCCATGATTTGGATGTGAGCCAGGGCGTGTTCCAGGTGAA
AGACGANGGCCCGAGCATTGACGGCAGCAAGGTGCTGTCTGCCGATGTGNTGACGGTGGATGAAACGAAT
TTGGGCGNNAANGCGACGGCCAGTTTTGCTGATAANTTTGCCCAGGCCATTGATTTTGGTGAAGACGGGG
CAGGCTCTGTGACCTATGCCCTGGTATTGAATGGCAGCAACGTGGGCTCAGGGCTGTATGCCATTGATAA
CCTGGATGTGAGNACAGCAGACGGTGACGGCATNGGGCGGGGCGGTGAGATTGTATTAAACCAAAACGGC
AATGTGGTGACCGGCAGCCTGGGCGGCGTGGATTATTTTACGATTACCATTGATGAGGCGAGCGGTGAGG
TGGTGTTTGANCAGCTGGCTTCGGTATGGCATGNCAATACGGCGAACCCCGACGACCAGTCCGCTTTACA
GGCTCTGGCCAACAGTTTGGTGGTTCGGGCCACGGTAGTGGATGCCGACGGNGATCAGGCTGTCCATGAT
TTGGATGTGAGCCAGGGCGTGTTCCAGGTGAAAGACGANGGCCCGAGCATTGACGGCAGCAAGGTGCTGT
CTGCCGATGTGNTGACGGTGGATGAAACGAATTTGGGCGNNAANGCGACGGCCAGTTTTGCTGATAANTT
TGCCCAGGCCATTGATTTTGGTGAAGACGGGGCAGGCTCTGTGACCTATGCCCTGGTATTGAATGGCAGC
AACGTGGGCTCAGGGCTGTATGCCATTGATAACCTGGATGTGAGNACAGCAGACGGTGACGGCATNGGGC
GGGGCGGTGAGATTGTATTAAACCAAAACGGCAATGTGGTGACCGGCAGCCTGGGCGGCGTGGATTATTT
TACGATTACCATTGATGAGGCGAGCGGTGAGGTGGTGTTTGANCAGCTGGCTTCGGTATGGCATGNCAAT
ACGGCGAACCCCGACGACCAGTCCGCTTTACAGGCTCTGGCCAACAGTTTGGTGGTTCGGGCCACGGTAG
TGGATGCCGACGGNGATCAGGCTGTCCATGATTTGGATGTGAGCCAGGGCGTGTTCCAGGTGAAAGACGA
NGGCCCGAGCATTGACGGCAGCAAGGTGCTGTCTGCCGATGTGNTGACGGTGGATGAAACGAATTTGGGC
GNNAANGCGACGGCCAGTTTTGCTGATAANTTTGCCCAGGCCATTGATTTTGGTGAAGACGGGGCAGGCT
CTGTGACCTATGCCCTGGTATTGAATGGCAGCAACGTGGGCTCAGGGCTGTATGCCATTGATAACCTGGA
TGTGAGNACAGCAGACGGTGACGGCATNGGGCGGGGCGGTGAGATTGTATTAAACCAAAACGGCAATGTG
GTGACCGGCAGCCTGGGCGGCGTGGATTATTTTACGATTACCATTGATGAGGCGAGCGGTGAGGTGGTGT
TTGANCAGCTGGCTTCGGTATGGCATGNCAATACGGCGAACCCCGACGACCAGTCCGCTTTACAGGCTCT
GGCCAACAGTTTGGTGGTTCGGGCCACGGTAGTGGATGCCGACGGNGATCAGGCTGTCCATGATTTGGAT
GTGAGCCAGGGCGTGTTCCAGGTGAAAGACGANGGCCCGAGCATTGACGGCAGCAAGGTGCTGTCTGCCG
ATGTGNTGACGGTGGATGAAACGAATTTGGGCGNNAANGCGACGGCCAGTTTTGCTGATAANTTTGCCCA
GGCCATTGATTTTGGTGAAGACGGGGCAGGCTCTGTGACCTATGCCCTGGTATTGAATGGCAGCAACGTG
GGCTCAGGGCTGTATGCCATTGATAACCTGGATGTGAGNACAGCAGACGGTGACGGCATNGGGCGGGGCG
GTGAGATTGTATTAAACCAAAACGGCAATGTGGTGACCGGCAGCCTGGGCGGCGTGGATTATTTTACGAT
TACCATTGATGAGGCGAGCGGTGAGGTGGTGTTTGANCAGCTGGCTTCGGTATGGCATGNCAATACGGCG
AACCCCGACGACCAGTCCGCTTTACAGGCTCTGGCCAACAGTTTGGTGGTTCGGGCCACGGTAGTGGATG
CCGACGGNGATCAGGCTGTCCATGATTTGGATGTGAGCCAGGGCGTGTTCCAGGTGAAAGACGANGGCCC
GAGCATTGACGGCAGCAAGGTGCTGTCTGCCGATGTGNTGACGGTGGATGAAACGAATTTGGGCGNNAAN
GCGACGGCCAGTTTTGCTGATAANTTTGCCCAGGCCATTGATTTTGGTGAAGACGGGGCAGGCTCTGTGA
CCTATGCCCTGGTATTGAATGGCAGCAACGTGGGCTCAGGGCTGTATGCCATTGATAACCTGGATGTGAG
NACAGCAGACGGTGACGGCATNGGGCGGGGCGGTGAGATTGTATTAAACCAAAACGGCAATGTGGTGACC
GGCAGCCTGGGCGGCGTGGATTATTTTACGATTACCATTGATGAGGCGAGCGGTGAGGTGGTGTTTGANC
AGCTGGCTTCGGTATGGCATGNCAATACGGCGAACCCCGACGACCAGTCCGCTTTACAGGCTCTGGCCAA
CAGTTTGGTGGTTCGGGCCACGGTAGTGGATGCCGACGGNGATCAGGCTGTCCATGATTTGGATGTGAGC
CAGGGCGTGTTCCAGGTGAAAGACGANGGCCCGAGCATTGACGGCAGCAAGGTGCTGTCTGCCGATGTGN
TGACGGTGGATGAAACGAATTTGGGCGNNAANGCGACGGCCAGTTTTGCTGATAANTTTGCCCAGGCCAT
TGATTTTGGTGAAGACGGGGCAGGCTCTGTGACCTATGCCCTGGTATTGAATGGCAGCAACGTGGGCTCA
GGGCTGTATGCCATTGATAACCTGGATGTGAGNACAGCAGACGGTGACGGCATNGGGCGGGGCGGTGAGA
TTGTATTAAACCAAAACGGCAATGTGGTGACCGGCAGCCTGGGCGGCGTGGATTATTTTACGATTACCAT
TGATGAGGCGAGCGGTGAGGTGGTGTTTGANCAGCTGGCTTCGGTATGGCATGNCAATACGGCGAACCCC
GACGACCAGTCCGCTTTACAGGCTCTGGCCAACAGTTTGGTGGTTCGGGCCACGGTAGTGGATGCCGACG
GNGATCAGGCTGTCCATGATTTGGATGTGAGCCAGGGCGTGTTCCAGGTGAAAGACGANGGCCCGAGCAT
TGACGGCAGCAAGGTGCTGTCTGCCGATGTGNTGACGGTGGATGAAACGAATTTGGGCGNNAANGCGACG
GCCAGTTTTGCTGATAANTTTGCCCAGGCCATTGATTTTGGTGAAGACGGGGCAGGCTCTGTGACCTATG
CCCTGGTATTGAATGGCAGCAACGTGGGCTCAGGGCTGTATGCCATTGATAACCTGGATGTGAGNACAGC
AGACGGTGACGGCATNGGGCGGGGCGGTGAGATTGTATTAAACCAAAACGGCAATGTGGTGACCGGCAGC
CTGGGCGGCGTGGATTATTTTACGATTACCATTGATGAGGCGAGCGGTGAGGTGGTGTTTGANCAGCTGG
CTTCGGTATGGCATGNCAATACGGCGAACCCCGACGACCAGTCCGCTTTACAGGCTCTGGCCAACAGTTT
GGTGGTTCGGGCCACGGTAGTGGATGCCGACGGNGATCAGGCTGTCCATGATTTGGATGTGAGCCAGGGC
GTGTTCCAGGTGAAAGACGANGGCCCGAGCATTGACGGCAGCAAGGTGCTGTCTGCCGATGTGNTGACGG
TGGATGAAACGAATTTGGGCGNNAANGCGACGGCCAGTTTTGCTGATAANTTTGCCCAGGCCATTGATTT
TGGTGAAGACGGGGCAGGCTCTGTGACCTATGCCCTGGTATTGAATGGCAGCAACGTGGGCTCAGGGCTG
TATGCCATTGATAACCTGGATGTGAGNACAGCAGACGGTGACGGCATNGGGCGGGGCGGTGAGATTGTAT
TAAACCAAAACGGCAATGTGGTGACCGGCAGCCTGGGCGGCGTGGATTATTTTACGATTACCATTGATGA
GGCGAGCGGTGAGGTGGTGTTTGANCAGCTGGCTTCGGTATGGCATGNCAATACGGCGAACCCCGACGAC
CAGTCCGCTTTACAGGCTCTGGCCAACAGTTTGGTGGTTCGGGCCACGGTAGTGGATGCCGACGGNGATC
AGGCTGTCCATGATTTGGATGTGAGCCAGGGCGTGTTCCAGGTGAAAGACGACGGCCCGAGCATTGACGG
CAGCAAGGTGCTGTCTGCCGATGTGCTGACGGTGGATGAAACGAATTTGGGCGCTAACGCGACGGCCAGT
TTTGCTGATAATTTTGCCCAGGCCATTGATTTTGGTGAAGACGGGGCAGGCTCTGTGACCTATGCCCTGG
TATTGAATGGCAGCAACGTGGGCTCAGGGCTGTATGCCATTGATAACCTGGATGTGAGCACAGCAGACGG
TGACGGCATCGGGCGGGGCGGTGAGATTGTATTAAACCAAAACGGCAATGTGGTGACCGGCAGCCTGGGC
GGCGTGGATTATTTTACGATTACCATTGATGAGGCGAGCGGTGAGGTGGTGTTTGACCAGCTGGCTTCGG
TATGGCATGCCAATACGGCGAACCCCGACGACCAGTCCGCTTTACAGGCTCTGGCCAACAGTTTGGTGGT
TCGGGCCACGGTAGTGGATGCCGACGGCGATCAGGCTGTCCATGATTTGGATGTGAGCCAGGGCGTGTTC
CAGGTGAAAGACGACGGCCCGAGCATTGACGGCAGCAAGGTGCTGTCTGCCGATGTGCTGACGGTGGATG
AAACGAATTTGGGCGCTAACGCGACGGCCAGTTTTGCTGATAATTTTGCCCAGGCCATTGATTTTGGTGA
AGACGGGGCAGGCTCTGTGACCTATGCCCTGGTATTGAATGGCAGCAACGTGGGCTCAGGGCTGTATGCC
ATTGATAACCTGGATGTGAGCACAGCAGACGGTGACGGCATCGGGCGGGGCGGTGAGATTGTATTAAACC
AAAACGGCAATGTGGTGACCGGCAGCCTGGGCGGCGTGGATTATTTTACGATTACCATTGATGAGGCGAG
CGGTGAGGTGGTGTTTGAGCAGCTGGCTTCGGTATGGCATGCCAATACGGCGAACCCCGACGACCAGTCC
GCTTTACAGGCTCTGGCCAACAGTTTGGTGGTTCGGGCCACGGTAGTGGATGCCGACGGCGATCAGGCTG
TCCATGATTTGGATGTGAGCCAGGGCGTGTTCCAGGTGAAAGACGACGGCCCGAGCATTGACGGCAGCAA
GGTGCTGTCTGCCGATGTGCTGACGGTGGATGAAACGAATTTGGGCGCTAACGCGACGGCCAGTTTTGCT
GATAATTTTGCCCAGGCCATTGATTTTGGTGAAGACGGGGCAGGCTCTGTGACCTATGCCCTGGTATTGA
ATGGCAGCAACGTGGGCTCAGGGCTGTATGCCATTGATAACCTGGATGTGAGCACAGCAGACGGTGACGG
CATCGGGCGGGGCGGTGAGATTGTATTAAACCAAAACGGCAATGTGGTGACCGGCAGCCTGGGCGGCGTG
GATTATTTTACGATTACCATTGATGAGGCGAGCGGTGAGGTGGTGTTTGAGCAGCTGGCTTCGGTATGGC
ATGCCAATACGGCGAACCCCGACGACCAGTCCGCTTTACAGGCTCTGGCCAACAGTTTGGTGGTTCGGGC
CACGGTAGTGGATGCCGACGGCGATCAGGCTGTCCATGATTTGGATGTGAGCCAGGGCGTGTTCCAGGTG
AAAGACGACGGCCCGAGCATTGACGGCAGCAAGGTGCTGTCTGCCGATGTGCTGACGGTGGATGAAACGA
ATTTGGGCGCTAACGCGACGGCCAGTTTTGCTGATAATTTTGCCCAGGCCATTGATTTTGGTGAAGACGG
GGCAGGCTCTGTGACCTATGCCCTGGTATTGAATGGCAGCAACGTGGGCTCAGGGCTGTATGCCATTGAT
AACCTGGATGTGAGCACAGCAGACGGTGACGGCATCGGGCGGGGCGGTGAGATTGTATTAAACCAAAACG
GCAATGTGGTGACCGGCAGCCTGGGCGGCGTGGATTATTTTACGATTACCATTGATGAGGCGAGCGGTGA
GGTGGTGTTTGACCAGCTGGCTTCGGTATGGCATGGCAATACGGCGAACCCCGACGACCAGTCCGCTTTA
CAGGCTCTGGCCAACAGTTTGGTGGTTCGGGCCACGGTAGTGGATGCCGACGGCGATCAGGCTGTCCATG
ATTTGGATGTGAGCCAGGGCGTGTTCCAGGTGAAAGACGATGGCCCGAGCATTGACGGCAGCAAGGTGCT
GTCTGCCGATGTGCTGACGGTGGATGAAACGAATTTGGGCGCTAACGCGACGGCCAGTTTTGCTGATAAT
TTTGCCCAGGCCATTGATTTTGGTGAAGACGGGGCAGGCTCTGTGACCTATGCCCTGGTATTGAATGGCA
GCAACGTGGGCTCAGGGCTGTATGCCATTGATAACCTGGATGTGAGCACAGCAGACGGTGACGGCATCGG
GCGGGGCGGTGAGATTGTATTAAACCAAAACGGCAATGTGGTGACCGGCAGCCTGGGCGGCGTGGATTAT
TTTACGATTACCATTGATGAGGCGAGCGGTGAGGTGGTGTTTGACCAGCTGGCTTCGGTATGGCATGGCA
ATACGGCGAACCCCGACGACCAGTCCGCTTTACAGGCTCTGGCCAACAGTTTGGTGGTTCGGGCCACGGT
AGTGGATGCCGACGGCGATCAGGCTGTCCATGATTTGGATGTGAGCCAGGGCGTGTTCCAGGTGAAAGAC
GACGGCCCGAGCATTGACGGCAGCAAGGTGCTGTCTGCCGATGTGCTGACGGTGGATGAAACGAATTTGG
GCGCTAACGCGACGGCCAGTTTTGCTGATAACTTTGCCCAGGCCATTGATTTTGGTGAAGACGGGGCAGG
CTCTGTGACCTATGCCCTGGTATTGAATGGCAGCAACGTGGGCTCAGGGCTGTATGCCATTGATAACCTG
GATGTGAGTACAGCAGACGGTGACGGCATCGGGCGGGGCGGTGAGATTGTATTAAACCAAAACGGCAATG
TGGTGACCGGCAGCCTGGGCGGCGTGGATTATTTTACGATTACCATTGATGAGGCGAGCGGTGAGGTGGT
GTTTGACCAGCTGGCTTCGGTATGGCATGCCAATACGGCGAACCCCGACGACCAGTCCGCTTTACAGGCT
CTGGCCAACAGTTTGGTGGTTCGGGCCACGGTAGTGGATGCCGACGGTGATCAGGCTGTCCATGATTTGG
ATGTGAGCCAGGGCGTGTTCCAGGTGAAAGACGACGGCCCGAGCGTGAGCTCAACGAAACTGACTGGCGT
GGTGGATGAAGACGGCCTGGCAGGCGGCATTGCCGGGGGCACAGGCGATGTGGCCGGTCAGGCGGTAGCG
GCTTCAGGCAACGTGGCCACCTTGTTCCAAAGCGGAGCGGATGCCCCACTGAGCTATTCCTTGAACCCCA
ACACCAGCGGCTTGCCGGCTTTAAGTTCCGGTGGCGTGGCTCTGACTTATGCGGTGTCCGGTGGTACGCT
GACGGCGTCTGCAGGCAGCACGCAGGTCTTTACCTTCACGCTCAATGCCAACGGCAATTACACGTTCACC
TTGCTGGCGAAGCTCGATCACCCCGCCGGGGCGGATGAAAACGACATTACCATCAATTTGGGCTCTGTCA
TTAGGGCAACAGACAGCGACGGGGACACGGTAGTGGCCGCAGCCGATGGGCTTGTGATTACAGTAGACGA
CGACACGCCGGTTGCGAGTACAACGAAACTGACTGGCGTGGTGGATGAAGACGGCCTGGCAGGCGGCATT
GCCGGGGGCACAGGCGATGTGGCCGGTCAGGCGGTAGCGGCTTCAGGCAACGTGGCCACCTTGTTCCAAA
GCGGAGCGGATGCCCCACTGAGCTATTCCTTGAACCCCAACACCAGCGGCTTGCCGGCTTTAAGTTCCGG
TGGCGTGGCTCTGACTTATGCGGTGTCCGGTGGTACGCTGACGGCGTCTGCAGGCAGCACGCAGGTCTTT
ACCTTCACGCTCAATGCCAACGGCAATTACACGTTCACCTTGCTGGCGAAGCTCGATCACCCCGCCGGGG
CGGATGAAAACGACATTACCATCAATTTGGGCTCTGTCATTAGGGCAACAGACAGCGACGGGGACACGGT
AGTGGCCGCGGCCGATGGGCTTGTGATTACAGTAGACGACGACACGCCGATTGCGAGTGCAACGAAACTG
ACTGGCGTGGTGGATGAAGACGGCCTGGCAGGCGGCATTGCCGGGGGCACAGGCGATGTGGCCGGTCAGG
CGGTAGCGGCTTCAGGCAACGTGGCCACCTTGTTCCAAAGCGGAGCGGATGCCCCACTGAGCTATTCCTT
GAACCCCAACACCAGCGGCTTGCCGGCTTTAAGTTCCGGTGGCGTGGCTCTGACTTATGCGGTGTCCGGT
GGTACGCTGACGGCGTCTGCAGGCAGCACGCAGGTCTTTACCTTCACGCTCAATGCCAACGGCAATTACA
CGTTCACCTTGCTGGCGAAGCTCGATCACCCCGCCGGGGCGGATGAAAACGACATTACCATCAATTTGGG
CTCTGTCATTAGGGCAACAGACAGCGACGGGGACACGGTAGTGGCCGCAGCCGATGGGCTTGTGATTACA
GTAGACGACGACACGCCGGTTGCGAGTGCAACGAAACTGACTGGCGTGGTGGATGAAGACGGCCTGGCAG
GCGGCATTGCCGGGGGCACAGGCGATGTGGCCGGTCAGGCGGTAGCGGCTTCAGGCAACGTGGCCACCTT
GTTCCAAAGCGGAGCGGATGCCCCACTGAGCTATTCCTTGAACCCCAACACCAGCGGCTTGCCGGCTTTA
AGTTCCGGTGGCGTGGCTCTGACTTATGCGGTGTCCGGTGGTACGCTGACGGCGTCTGCAGGCAGCACGC
AGGTCTTTACCTTCACGCTCAATGCCAACGGCAATTACACGTTCACCTTGCTGGCGAAGCTCGATCACCC
CGCCGGGGCGGATGAAAACGACATTACCATCAATTTGGGCTCTGTCATTAGGGCAACAGACAGCGACGGG
GACACGGTAGTGGCCGCAGCCGATGGGCTTGTGATTACAGTAGACGACGACACGCCGGTTGCGAGTGCAA
CGAAACTGACTGGCGTGGTGGATGAAGACGGCCTGGCAGGCGGCATTGCCGGGGGCACAGGCGATGTGGC
CGGTCAGGCGGTAGCGGCTTCAGGCAACGTGGCCACCTTGTTCCAAAGCGGAGCGGATGCCCCACTGAGC
TATTCCTTGAACCCCAACACCAGCGGCTTGCCGGCTTTAAGTTCCGGTGGCGTGGCTCTGACTTATGCGG
TGTCCGGTGGTACGCTGACGGCGTCTGCAGGCAGCACGCAGGTCTTTACCTTCACGCTCAATGCCAACGG
CAATTACACGTTCACCTTGCTGGCGAAGCTCGATCACCCCGCCGGGGCGGATGAAAACGACATTACCATC
AATTTGGGCTCTGTCATTAGGGCAACAGACAGCGACGGGGACACGGTAGTGGCCGCGGCCGATGGGCTTG
TGATTACAGTAGACGACGACACGCCGGTTGCGAGTGCAACGAAACTGACTGGCGTGGTGGATGAAGACGG
CCTGGCAGGCGGCATTGCCGGGGGCACAGGCGATGTGGCCGGTCAGGCGGTAGCGGCTTCAGGCAACGTG
GCCACCTTGTTCCAAAGCGGAGCGGATGCCCCACTGAGCTATTCCTTGAACCCCAACACCAGCGGCTTGC
CGGCTTTAAGTTCCGGTGGCGTGGCTCTGACTTATGCGGTGTCCGGTGGTACGCTGACGGCGTCTGCAGG
CAGCACGCAGGTCTTTACCTTCACGCTCAATGCCAACGGCAATTACACGTTCACCTTGCTGGCGAAGCTC
GATCACCCCGCCGGGGCGGATGAAAACGACATTACCATCAATTTGGGCTCTGTCATTAGGGCAACAGACA
GCGACGGGGACACGGTAGTGGCCGCAGCCGATGGGCTTGTGATTACAGTAGACGACGACACGCCGGTTGC
GAGTGCAACGAAACTGACTGGCGTGGTGGATGAAGACGGCCTGGCAGGCGGCATTGCCGGGGGCACAGGC
GATGTGGCCGGTCAGGCGGTAGCGGCTTCAGGCAACGTGGCCACCTTGTTCCAAAGCGGAGCGGATGCCC
CACTGAGCTATTCCTTGAACCCCAACACCAGCGGCTTGCCGGCTTTAAGTTCCGGTGGCGTGGCTCTGAC
TTATGCGGTGTCCGGTGGTACGCTGACGGCGTCTGCAGGCAGCACGCAGGTCTTTACCTTCACGCTCAAT
GCCAACGGCAATTACACGTTCACCTTGCTGGCGAAGCTCGATCACCCCGCCGGGGCGGATGAAAACGACA
TTACCATCAATTTGGGCTCTGTCATTAGGGCAACAGACAGCGACGGGGACACGGTAGTGGCCGCAGCCGA
TGGGCTTGTGATTACAGTAGACGACGACACGCCGATTGCGAGTGCAACGAAACTGACTGGCGTGGTGGAT
GAAGACGGCCTGGCAGGCGGCATTGCCGGGGGCACAGGCGATGTGGCCGGTCAGGCGGTAGCGGCTTCAG
GCAACGTGGCCACCTTGTTCCAAAGCGGAGCGGATGCCCCACTGAGCTATTCCTTGAACCCCAACACCAG
CGGCTTGCCGGCTTTAAGTTCCGGTGGCGTGGCTCTGACTTATGCGGTGTCCGGTGGTACGCTGACGGCG
TCTGCAGGCAGCACGCAGGTCTTTACCTTCACGCTCAATGCCAACGGCAATTACACGTTCACCTTGCTGG
CGAAGCTCGATCACCCCGCCGGGGCGGATGAAAACGACATTACCATCAATTTGGGCTCTGTCATTAGGGC
AACAGACAGCGACGGGGACACGGTAGTGGCCGCGGCCGATGGGCTTGTGATTACAGTAGACGACGACACG
CCGATTGCGAGTGCAACGAAACTGACTGGCGTGGTGGATGAAGACGGCCTGGCAGGCGGCATTGCCGGGG
GCACAGGCGATGTGGCCGGTCAGGCGGTAGCGGCTTCAGGCAACGTGGCCACCTTGTTCCAAAGCGGAGC
GGATGCCCCACTGAGCTATTCCTTGAACCCCAACACCAGCGGCTTGCCGGCTTTAAGTTCCGGTGGCGTG
GCTCTGACTTATGCGGTGTCCGGTGGTACGCTGACGGCGTCTGCAGGCAGCACGCAGGTCTTTACCTTCA
CGCTCAATGCCAACGGCAATTACACGTTCACCTTGCTGGCGAAGCTCGATCACCCCGCCGGGGCGGATGA
AAACGACATTACCATCAATTTGGGCTCTGTCATTAGGGCAACAGACAGCGACGGGGACACGGTAGTGGCC
GCGGCCGATGGGCTTGTGATTACAATTGATGACGATATGCCTAAAGCATTTACCCCTGAAGAGGGCTTTG
TAACGAATCAAGCTGGTATTGTAAGAACATTTGATCTGGATTTTGATGCCAATATTGATAATAATGTCGG
TGCTGATCAACCAGGTACAATTGCTTTTTCAGGTATCACTAACGGGCAACTTGTTACAGGAACAGTTGAT
GGTGTTCCTAATCAGACTTTAACTTCTGGAGGGTCTGCCATTCATTATTACGTGAGTGGTAATAATGTGG
TTGAGGGCTGGATTAATGGCGGGCCTGGTGACGTGGGTTCCACAATTGTGTTTAGGACTACTTTGCAGCC
GGATATGAACTATAACGCAAGCAATGACACCTATAAATTTGAATTGTTCCAGCCTATTAGTACATCAACG
AATGTGAGTATTACAAATTTTAATGGGGTTAATGCGACTAGCAGAGAGTTCATATATCTTGAGAATGCTA
GTGCCCCTGGAGAAGATATATTATTTTCTGGTTACATACGAAACGATAATGGCAGCTTTACTGACGCTAC
TGTTAATACAAGCACTCAGGGCATAGGTGTCAATAATCAAAATATGAATGATCGCGAGAATTTACGCCTT
GATTTTGTCAGAAATGCTTCTACAACTGGCACAAATCAAAATATGACTTATGAATACGATGATCATTATA
CGGTTAATAATTTTAGTTTTAAAATTGTTCAGGTTACAGGAAGTCCTCCGGCAGGTTCAATAGAAGTATG
GGTTCGTGCTTATAATGCGGATGATGATGATCCAACTAACAATACAGTTAGTTCTGCAAATAATTTAGCG
CATCAAAATGCATTGAGAGATGATCCGCAAGTAGCTCTCACACAAATTTTAGTGAATGGTGTGCCGGTTA
CTCCAACCGCCGTTAATGCTAGTGGTGGGTATTTAATTAGCGGCTTAAATTTAAATGATACGATAACACT
TAGATCAGCTAATGGATATGATCGCGTAGAAATAGAAAACGCACGTTCAGGCGCTCATGGAGTTTCAAAC
TCCAGTTTAAATGGTGAAACATTTGATATTGGCTTATTCTCTTACAATACAATTAAAACTACTCCTTCTG
AAATCAATATTAATATGGGTCTTTCATTGACTGATTCAGATGGTGATAAAGTAACTTCTTCAATAGAAAT
TAATCTGTCTCCTTCGGTATTTAAGGTTGGAGAAAATGTCGATGATACTTCCAGCTCTAATGTCTCTCAC
CGTGTAGGAGGTGACACTGGTGTTATCGACAGTTCTGGTGGCGCGGATATTTTGGTTGGTGATGTTGGCG
GTGTAGAGATTATTGGTACTACTGCTCGAATTGCATTTATCTTGGATGAATCAGGCAGTATGGATCAAAA
TTTCGGAGGAACAACTCGGTTAGAAGTATTAAAACAAACGATGACTGATATATTAACTGAGTTAAGTAAT
ACACCTAATGCCAGTATTACAGTTCATTTAGTCAAATTTGCATCAGTAGTTAATGGTACAGGCACTTTTG
AAATTACTGGTGGAGAATTGCAACAGGCTTTAGACTTTATATCTGGATTACAGATACAACAAGGTTTATT
AGCTGGAACAAACTATGAGGCAGCTTTAGGGCAAACCTTACAATGGTATAATAGTCAGTCTGGAACAGTG
GATGTGCAACAAACTCTATTTTTTACTGATGGCGCTCCTACTTTTTATATGGATGGGAATAGTACTGAAT
ATACAAATATTGCTCGTGTCTATGGAAATGGAAGCCAAACAGAGGAAGTTCTCTGGGAAAATCTATTCGG
TGAGCATGCTGGAGGACAAGCTACATCGGATCGAATTAATAATCTCACAGAGTCTGACTCCAGAGATTTG
GATGGTACTCAAAGCTATTCTGTTGACACTAATGGTGATGGTATTTTTGAAACTCAATCGGTAAATTCAC
GTAGTTTTGGAACAACACAAAATACAAATGACTACGTAAGAAGTATTGCAGATACTTTCAATGAAGTAGA
CGCTTTGCAAGCGCATGGACCTTTGCGTGCGGTTTCCATAGCGGATAATTTTAGCGTTTATTTACAAGAA
ATAGATAGTACAGGCCAACCTTATATTGCTGACTCTCCTGAAGTGTTACAAGATATACTGGATGAATTAA
ATCCATTTAATGTTTTGCTTTCAGCGGGTAGTGATACCATTCAAGCTAATGAGGAAAATGATTTAATCTT
TGGGGATGTGTTATTCACTGATAAACTGGCTGAAGATGAAGGTCTTGATTTACCTAAAGGATCAGGTTGG
GCAGTATTTGAAGAACTGGAAGCCAATCATGGATGGAGTAGGCAAGATACCTTGGATTATATAAAAAATC
ATGCTGATGAACTTGGCAGAGAAACAGTACTCTCTAGTGGTAGTAAACGTTCTGGTGGACATGACACCAT
TAGCGGAGGCCAGGGAGATGACAGAATATACGGACAGGAAGGTAATGATATCATTGACGCTGGTTCTGGG
GATGATGTCATTGTGGGTGGAACAGGCAATGATACACTCACCGGTGGCGCAGGGGCTGATCAATTTGTGC
TCGTGAAAGGACAAGGTGGTGCTAGTGCAGGCGCAGCTCCGATCGACACTATTACAGACTTTGAAGTGAA
TATTGATAAGATTGTTATTAACGGTAATAACATTACTGGTGTCAGTGTATCTACCCCTGTCTCTAACACT
TATACTATAACGGTTAGTTATTCTGATGCTGCTACTACGGAACACTTTAAAGTGACATTATCCAATGGTG
CTTTATTGAATGATTCTGGAAAAACTCATTTGAACGGAGTGGTTATAAGCGGTGGCACAGCTACTATTGA
TGGCACAATTGTTGGCGCCGTTTTGTATCTGGATCTGAATGCCAATAATCAGGAAGATGAAGGGGAACGA
CTGGGTATTACCAATCAATATGGTCATGTGGAATGGGTCGTTGATCTCTCTAAATTTGATGTCAACGGTG
ATGGCCAGTACGTTATAGGTGAGGCTCGTGCCGTTCAAACGGGTGGTTTTGATATAGATACGGGTTTAAG
TTATGAAATTAATCTTTACGGGCCAGTAGGTTCAGCAGTCATATCACCATTGACAAGCCTCTTGCAAGCT
CAGTTAGAAGCCGGTATGGATTATGAGACAGCTAATGCTGCTTTGGTCGCGCGCTTGGGACTGCCTGAGG
GAACACAAATTATCAGTTTCAGTCCCATTACTGGCAGCGGTGAAGTCCTGGCTCAAAACGCAGGTGTAAT
GACTGCGGCCATTCAGTTTGCTGAAATAGCCGCAATACACTATTCAACCGATGAAAGCCATGTTTCATTC
GCTGTCTTTGAGGCAATTAGCAAGGCATTGTTTGAACTTCCTGAAGGGCTAGTCGCTGATTTTAGCGATC
AGGGTTTCTTACAGTCTATTTCAAATCATCTGGGATTAGATGCTCTGGTTACAGCGGATATGATTGACTA
TATGGCAGCTGGCCAGAAAGCGTTAGAGGCCAGTATTTTGACTCTTGCGCCCGGAGAAGATGCTCTGACT
GCCATCAGCAAGATACAGCATGTGACCCAAGGTATATATGCCCAAGCTATTGAAATGGCATTGATAGGGT
ATTTGCCATTAGATGCTCTTAAAAACATGAGTGCCGTTCTTAAGGCTTATGCTGATGGAGATATTACGGA
TGAACAACTCAATTCTTTTGAAGACAAGCTTTCCGCTGTGGTTGTGAATTGGGAAGAGAATAATGTTATG
GACACATCTCATCAGGCTTCATTGCAAACAGATCGTACTGTTGATGACTCTTCAGTCAAATCAGAGGTGA
ATCATGAAATGGCGCAAGAAGTTAATGCCGTGATTAATGATTTTATGGATGAACATAATATTTCTTTGTA
CTATTATGCTCAACAGGCTCAAATGCCTCAAGAAGCACAAGAACAACAACCAACAGAGGATCAGGCTGAA
GAGACGGTCATGCATGACGACGTTGTTCAAGATTTGTTGCTTGATGATCATAGCCTTACCATGTTGGCCA
ATAATCCCCAATTAAACGGTGGTAATGGCAATGATGTTCTGCATGGAACTACCGGAAACGATTTTATAAG
AGGCGGTCAAGGAAATGATACGATGACAGGTGGTGGCGGTGTTGATACGTTCTTCTGGTTAAGTGGCGAC
GATGATGGTGGTGTGGATACTATTACCGATTTCAAAGCAAATCCTGTTGATCAATCATCAGATGCCAGCG
TCCTTAACTTAAGTGATTTGCTATCTGATGCGGATCTGGAAACCAATAGTTTGGATAATTATCTGAATGT
TTCTACCACAGAAGAAGGTGATACAACCATTAAAGTAGACCCTAATGGTAATGGAAACTTTGACGCTCCA
GCGCAAACAATTATATTAGAAGACGTGGATTTAACAGCTGTTTTTGCTACCAACAATTCGCATGATATTG
TGAATCAAATGATCGCTAATGGAAACTTGATAGTAGAACAGTAAGATGAACTCATTACATTGGTGAATAT
GGAATTCACCAAT

Protein Sequence
>gi|54293628|ref|YP_126043.1| structural toxin protein RtxA [Legionella pneumophila str. Lens]
MLAESVIGIVRAVNGLLEKVNAQGQASIVKSGARLQEGDVLTLLSGEAYIQFIHGFPEALALGKPVNLYG
VSPILQYGVEELNEQLVQEAIAKGIDPSIILDVLGSAAAGAEAVGSGGDAFIIDPLFGFGQVTAGYPTGP
ISFAYEADTQHLFWYVPEETGVIAESELASEPESIPQVPQFTSNQATITVFEDALPSGGIRDSVEQTTTA
RASLSPLISSSSEVAASFAFNTNLSVLPKLQSGGLELEYILSSDHLALSATTPDGADVVRFELTADGQLT
QILIGSIDHPRADSDDSEWHRLDLSPVIDVTFTRISDGTFLGSRTLPASAAMAEIQDDVPIARVQLTNNE
ILLDETVGIKFGDADAANDDFNPTTTADPFNNTYGRPIGLVQNANLLDTSTSEMGGDYKNATMTHLLKIT
DAVSGLQTSDGTPINLFLESNGDITGRAGDIGAPAVFAIRMNPNTGSITVAQYGSIKQFDTNSHDEAVDL
TGRISAVVTVKDSDGDVSNVEIPIGQQIIFEDDGPSIDGSKVLSADVLTVDETNLGANATASFADNFAQA
IDFGEDGAGSVTYALVLNGSNVGSGLYAIDNLDVSTADGDGIGRGGEIVLNQNGNVVTGSLGGVDYFTIT
IDEASGEVVFEQLASVWHANTANPDDQSALQALANSLVVRATVVDADGDQAVHDLDVSQGVFQVKDDGPS
IDGSKVLSADVLTVDETNLGANATASFADNFAQAIDFGEDGAGSVTYALVLNGSNVGSGLYAIDNLDVST
ADGDGIGRGGEIVLNQNGNVVTGSLGGVDYFTITIDEASGEVVFDQLASVWHGNTANPDDQSALQALANS
LVVRATVVDADGDQAVHDLDVSQGVFQVKDDGPSIDGSKVLSADVLTVDETNLGANATASFADNFAQAID
FGEDGAGSVTYALVLNGSNVGSGLYAIDNLDVSTADGDGIGRGGEIVLNQNGNVVTGSLGGVDYFTITID
EASGEVVFEQLASVWHANTANPDDQSALQALANSLVVRATVVDADGDQAVHDLDVSQGVFQVKDDSPSID
GSKVLSADVLTVDETNLGANATASFADNFAQAIDFGEDGAGSVTYALVLNGSNVGSGLYAIDNLDVSTAD
GDGIGRGGEIVLNQNGNVVTGSLGGVDYFTITIDEASGEVVFEQLASVWHANTANPDDQSALQALANSLV
VRATVVDADGDQAVHDLDVSQGVFQVKDDGPSIDGSKVLSADVLTVDETNLGANATASFADNFAQAIDFG
EDGAGSVTYALVLNGSNVGSGLYAIDNLDVSTADGDGIGRGGEIVLNQNGNVVTGSLGGVDYFTITIDEA
SGEVVFEQLASVWHANTANPDDQSALQALANSLVVRATVVDADGDQAVHDLDVSQGVFQVKDDGPSIDGS
KVLSADVLTVDETNLGANATASFADNFAQAIDFGEDGAGSVTYALVLNGSNVGSGLYAIDNLDVSTADGD
GIGRGGEIVLNQNGNVVTGSLGGVDYFTITIDEASGEVVFEQLASVWHANTANPDDQSALQALANSLVVR
ATVVDADGDQAVHDLDVSQGVFQVKDDGPSIDGSKVLSADVLTVDETNLGANATASFADNFAQAIDFGED
GAGSVTYALVLNGSNVGSGLYAIDNLDVSTADGDGIGRGGEIVLNQNGNVVTGSLGGVDYFTITIDEASG
EVVFDQLASVWHGNTANPDDQSALQALANSLVVRATVVDADGDQAVHDLDVSQGVFQVKDDGPSIDGSKV
LSADVLTVDETNLGVNATASFADNFAQAIDFGEDGAGSVTYALVLNGSNVGSGLYAIDNLDVSTADGDGI
GRGGEIVLNQNGNVVTGSLGGVDYFTITIDEASGEVVFEQLASVWHANTANPDDQSALQALANSLVVRAT
VVDADGDQAVHDLDVSQGVFQVKDDGPSIDGSKVLSADVLTVDETNLGANATASFADNFAQAIDFGEDGA
GSVTYALVLNGSNVGSGLYAIDNLDVSTADGDGIGRGGEIVLNQNGNVVTGSLGGVDYFTITIDEASGEV
VFDQLASVWHGNTANPDDQSALQALANSLVVRATVVDADGDQAVHDLDVSQGVFQVKDXGPSIDGSKVLS
ADVXTVDETNLGXXATASFADXFAQAIDFGEDGAGSVTYALVLNGSNVGSGLYAIDNLDVXTADGDGXGR
GGEIVLNQNGNVVTGSLGGVDYFTITIDEASGEVVFXQLASVWHXNTANPDDQSALQALANSLVVRATVV
DADGDQAVHDLDVSQGVFQVKDXGPSIDGSKVLSADVXTVDETNLGXXATASFADXFAQAIDFGEDGAGS
VTYALVLNGSNVGSGLYAIDNLDVXTADGDGXGRGGEIVLNQNGNVVTGSLGGVDYFTITIDEASGEVVF
XQLASVWHXNTANPDDQSALQALANSLVVRATVVDADGDQAVHDLDVSQGVFQVKDXGPSIDGSKVLSAD
VXTVDETNLGXXATASFADXFAQAIDFGEDGAGSVTYALVLNGSNVGSGLYAIDNLDVXTADGDGXGRGG
EIVLNQNGNVVTGSLGGVDYFTITIDEASGEVVFXQLASVWHXNTANPDDQSALQALANSLVVRATVVDA
DGDQAVHDLDVSQGVFQVKDXGPSIDGSKVLSADVXTVDETNLGXXATASFADXFAQAIDFGEDGAGSVT
YALVLNGSNVGSGLYAIDNLDVXTADGDGXGRGGEIVLNQNGNVVTGSLGGVDYFTITIDEASGEVVFXQ
LASVWHXNTANPDDQSALQALANSLVVRATVVDADGDQAVHDLDVSQGVFQVKDXGPSIDGSKVLSADVX
TVDETNLGXXATASFADXFAQAIDFGEDGAGSVTYALVLNGSNVGSGLYAIDNLDVXTADGDGXGRGGEI
VLNQNGNVVTGSLGGVDYFTITIDEASGEVVFXQLASVWHXNTANPDDQSALQALANSLVVRATVVDADG
DQAVHDLDVSQGVFQVKDXGPSIDGSKVLSADVXTVDETNLGXXATASFADXFAQAIDFGEDGAGSVTYA
LVLNGSNVGSGLYAIDNLDVXTADGDGXGRGGEIVLNQNGNVVTGSLGGVDYFTITIDEASGEVVFXQLA
SVWHXNTANPDDQSALQALANSLVVRATVVDADGDQAVHDLDVSQGVFQVKDXGPSIDGSKVLSADVXTV
DETNLGXXATASFADXFAQAIDFGEDGAGSVTYALVLNGSNVGSGLYAIDNLDVXTADGDGXGRGGEIVL
NQNGNVVTGSLGGVDYFTITIDEASGEVVFXQLASVWHXNTANPDDQSALQALANSLVVRATVVDADGDQ
AVHDLDVSQGVFQVKDXGPSIDGSKVLSADVXTVDETNLGXXATASFADXFAQAIDFGEDGAGSVTYALV
LNGSNVGSGLYAIDNLDVXTADGDGXGRGGEIVLNQNGNVVTGSLGGVDYFTITIDEASGEVVFXQLASV
WHXNTANPDDQSALQALANSLVVRATVVDADGDQAVHDLDVSQGVFQVKDXGPSIDGSKVLSADVXTVDE
TNLGXXATASFADXFAQAIDFGEDGAGSVTYALVLNGSNVGSGLYAIDNLDVXTADGDGXGRGGEIVLNQ
NGNVVTGSLGGVDYFTITIDEASGEVVFXQLASVWHXNTANPDDQSALQALANSLVVRATVVDADGDQAV
HDLDVSQGVFQVKDXGPSIDGSKVLSADVXTVDETNLGXXATASFADXFAQAIDFGEDGAGSVTYALVLN
GSNVGSGLYAIDNLDVXTADGDGXGRGGEIVLNQNGNVVTGSLGGVDYFTITIDEASGEVVFXQLASVWH
XNTANPDDQSALQALANSLVVRATVVDADGDQAVHDLDVSQGVFQVKDXGPSIDGSKVLSADVXTVDETN
LGXXATASFADXFAQAIDFGEDGAGSVTYALVLNGSNVGSGLYAIDNLDVXTADGDGXGRGGEIVLNQNG
NVVTGSLGGVDYFTITIDEASGEVVFXQLASVWHXNTANPDDQSALQALANSLVVRATVVDADGDQAVHD
LDVSQGVFQVKDDGPSIDGSKVLSADVLTVDETNLGANATASFADNFAQAIDFGEDGAGSVTYALVLNGS
NVGSGLYAIDNLDVSTADGDGIGRGGEIVLNQNGNVVTGSLGGVDYFTITIDEASGEVVFDQLASVWHAN
TANPDDQSALQALANSLVVRATVVDADGDQAVHDLDVSQGVFQVKDDGPSIDGSKVLSADVLTVDETNLG
ANATASFADNFAQAIDFGEDGAGSVTYALVLNGSNVGSGLYAIDNLDVSTADGDGIGRGGEIVLNQNGNV
VTGSLGGVDYFTITIDEASGEVVFEQLASVWHANTANPDDQSALQALANSLVVRATVVDADGDQAVHDLD
VSQGVFQVKDDGPSIDGSKVLSADVLTVDETNLGANATASFADNFAQAIDFGEDGAGSVTYALVLNGSNV
GSGLYAIDNLDVSTADGDGIGRGGEIVLNQNGNVVTGSLGGVDYFTITIDEASGEVVFEQLASVWHANTA
NPDDQSALQALANSLVVRATVVDADGDQAVHDLDVSQGVFQVKDDGPSIDGSKVLSADVLTVDETNLGAN
ATASFADNFAQAIDFGEDGAGSVTYALVLNGSNVGSGLYAIDNLDVSTADGDGIGRGGEIVLNQNGNVVT
GSLGGVDYFTITIDEASGEVVFDQLASVWHGNTANPDDQSALQALANSLVVRATVVDADGDQAVHDLDVS
QGVFQVKDDGPSIDGSKVLSADVLTVDETNLGANATASFADNFAQAIDFGEDGAGSVTYALVLNGSNVGS
GLYAIDNLDVSTADGDGIGRGGEIVLNQNGNVVTGSLGGVDYFTITIDEASGEVVFDQLASVWHGNTANP
DDQSALQALANSLVVRATVVDADGDQAVHDLDVSQGVFQVKDDGPSIDGSKVLSADVLTVDETNLGANAT
ASFADNFAQAIDFGEDGAGSVTYALVLNGSNVGSGLYAIDNLDVSTADGDGIGRGGEIVLNQNGNVVTGS
LGGVDYFTITIDEASGEVVFDQLASVWHANTANPDDQSALQALANSLVVRATVVDADGDQAVHDLDVSQG
VFQVKDDGPSVSSTKLTGVVDEDGLAGGIAGGTGDVAGQAVAASGNVATLFQSGADAPLSYSLNPNTSGL
PALSSGGVALTYAVSGGTLTASAGSTQVFTFTLNANGNYTFTLLAKLDHPAGADENDITINLGSVIRATD
SDGDTVVAAADGLVITVDDDTPVASTTKLTGVVDEDGLAGGIAGGTGDVAGQAVAASGNVATLFQSGADA
PLSYSLNPNTSGLPALSSGGVALTYAVSGGTLTASAGSTQVFTFTLNANGNYTFTLLAKLDHPAGADEND
ITINLGSVIRATDSDGDTVVAAADGLVITVDDDTPIASATKLTGVVDEDGLAGGIAGGTGDVAGQAVAAS
GNVATLFQSGADAPLSYSLNPNTSGLPALSSGGVALTYAVSGGTLTASAGSTQVFTFTLNANGNYTFTLL
AKLDHPAGADENDITINLGSVIRATDSDGDTVVAAADGLVITVDDDTPVASATKLTGVVDEDGLAGGIAG
GTGDVAGQAVAASGNVATLFQSGADAPLSYSLNPNTSGLPALSSGGVALTYAVSGGTLTASAGSTQVFTF
TLNANGNYTFTLLAKLDHPAGADENDITINLGSVIRATDSDGDTVVAAADGLVITVDDDTPVASATKLTG
VVDEDGLAGGIAGGTGDVAGQAVAASGNVATLFQSGADAPLSYSLNPNTSGLPALSSGGVALTYAVSGGT
LTASAGSTQVFTFTLNANGNYTFTLLAKLDHPAGADENDITINLGSVIRATDSDGDTVVAAADGLVITVD
DDTPVASATKLTGVVDEDGLAGGIAGGTGDVAGQAVAASGNVATLFQSGADAPLSYSLNPNTSGLPALSS
GGVALTYAVSGGTLTASAGSTQVFTFTLNANGNYTFTLLAKLDHPAGADENDITINLGSVIRATDSDGDT
VVAAADGLVITVDDDTPVASATKLTGVVDEDGLAGGIAGGTGDVAGQAVAASGNVATLFQSGADAPLSYS
LNPNTSGLPALSSGGVALTYAVSGGTLTASAGSTQVFTFTLNANGNYTFTLLAKLDHPAGADENDITINL
GSVIRATDSDGDTVVAAADGLVITVDDDTPIASATKLTGVVDEDGLAGGIAGGTGDVAGQAVAASGNVAT
LFQSGADAPLSYSLNPNTSGLPALSSGGVALTYAVSGGTLTASAGSTQVFTFTLNANGNYTFTLLAKLDH
PAGADENDITINLGSVIRATDSDGDTVVAAADGLVITVDDDTPIASATKLTGVVDEDGLAGGIAGGTGDV
AGQAVAASGNVATLFQSGADAPLSYSLNPNTSGLPALSSGGVALTYAVSGGTLTASAGSTQVFTFTLNAN
GNYTFTLLAKLDHPAGADENDITINLGSVIRATDSDGDTVVAAADGLVITIDDDMPKAFTPEEGFVTNQA
GIVRTFDLDFDANIDNNVGADQPGTIAFSGITNGQLVTGTVDGVPNQTLTSGGSAIHYYVSGNNVVEGWI
NGGPGDVGSTIVFRTTLQPDMNYNASNDTYKFELFQPISTSTNVSITNFNGVNATSREFIYLENASAPGE
DILFSGYIRNDNGSFTDATVNTSTQGIGVNNQNMNDRENLRLDFVRNASTTGTNQNMTYEYDDHYTVNNF
SFKIVQVTGSPPAGSIEVWVRAYNADDDDPTNNTVSSANNLAHQNALRDDPQVALTQILVNGVPVTPTAV
NASGGYLISGLNLNDTITLRSANGYDRVEIENARSGAHGVSNSSLNGETFDIGLFSYNTIKTTPSEININ
MGLSLTDSDGDKVTSSIEINLSPSVFKVGENVDDTSSSNVSHRVGGDTGVIDSSGGADILVGDVGGVEII
GTTARIAFILDESGSMDQNFGGTTRLEVLKQTMTDILTELSNTPNASITVHLVKFASVVNGTGTFEITGG
ELQQALDFISGLQIQQGLLAGTNYEAALGQTLQWYNSQSGTVDVQQTLFFTDGAPTFYMDGNSTEYTNIA
RVYGNGSQTEEVLWENLFGEHAGGQATSDRINNLTESDSRDLDGTQSYSVDTNGDGIFETQSVNSRSFGT
TQNTNDYVRSIADTFNEVDALQAHGPLRAVSIADNFSVYLQEIDSTGQPYIADSPEVLQDILDELNPFNV
LLSAGSDTIQANEENDLIFGDVLFTDKLAEDEGLDLPKGSGWAVFEELEANHGWSRQDTLDYIKNHADEL
GRETVLSSGSKRSGGHDTISGGQGDDRIYGQEGNDIIDAGSGDDVIVGGTGNDTLTGGAGADQFVLVKGQ
GGASAGAAPIDTITDFEVNIDKIVINGNNITGVSVSTPVSNTYTITVSYSDAATTEHFKVTLSNGALLND
SGKTHLNGVVISGGTATIDGTIVGAVLYLDLNANNQEDEGERLGITNQYGHVEWVVDLSKFDVNGDGQYV
IGEARAVQTGGFDIDTGLSYEINLYGPVGSAVISPLTSLLQAQLEAGMDYETANAALVARLGLPEGTQII
SFSPITGSGEVLAQNAGVMTAAIQFAEIAAIHYSTDESHVSFAVFEAISKALFELPEGLVADFSDQGFLQ
SISNHLGLDALVTADMIDYMAAGQKALEASILTLAPGEDALTAISKIQHVTQGIYAQAIEMALIGYLPLD
ALKNMSAVLKAYADGDITDEQLNSFEDKLSAVVVNWEENNVMDTSHQASLQTDRTVDDSSVKSEVNHEMA
QEVNAVINDFMDEHNISLYYYAQQAQMPQEAQEQQPTEDQAEETVMHDDVVQDLLLDDHSLTMLANNPQL
NGGNGNDVLHGTTGNDFIRGGQGNDTMTGGGGVDTFFWLSGDDDGGVDTITDFKANPVDQSSDASVLNLS
DLLSDADLETNSLDNYLNVSTTEEGDTTIKVDPNGNGNFDAPAQTIILEDVDLTAVFATNNSHDIVNQMI
ANGNLIVEQ

Molecule Role Virulence factor
Molecule Role Annotation MUTATION: rtxA mutant is attenuated in mice and doesn't grow as well in monocytes as the wild type (Cirillo et al., 2001).
References
Cirillo et al., 2001: Cirillo SL, Bermudez LE, El-Etr SH, Duhamel GE, Cirillo JD. Legionella pneumophila entry gene rtxA is involved in virulence. Infection and immunity. 2001; 69(1); 508-517. [PubMed: 11119544].