Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

mip from Legionella pneumophila str. Lens

Victor ID 1458
Gene Name mip from Legionella pneumophila str. Lens
Sequence Strain (Species/Organism) Legionella pneumophila str. Lens
NCBI Gene ID 3114458
NCBI Protein GI 54293773
Locus Tag lpl0829
Protein Accession YP_126188.1
Other Database IDs UniProtKB-ID: Q5WYB0_LEGPL
UniRef100: UniRef100_A5IGB8
UniRef90: UniRef90_A5IGB8
UniRef50: UniRef50_Q5ZXE0
UniParc: UPI00000010BA
EMBL: CR628337
EMBL-CDS: CAH15063.1
RefSeq_NT: NC_006369.1
GenomeReviews: CR628337_GR
KEGG: lpf:lpl0829
NMPDR: fig|297245.3.peg.700
LegioList: lpl0829
eggNOG: COG0545
HOGENOM: HBG731200
OMA: GLSIGNN
ProtClustDB: CLSK914199
BioCyc: LPNE297245:LPL0829-MONOMER
Taxonomy ID 297245
Gene Starting Position 939431
Gene Ending Position 940132
Gene Strand (Orientation) +
Protein Name macrophage infectivity potentiator
DNA Sequence
>gi|54292964:939431-940132 Legionella pneumophila str. Lens, complete genome
TATGAAGATGAAATTGGTGACTGCAGCTGTTATGGGGCTTGCAATGTCAACAGCAATGGCTGCAACCGAT
GCCACATCATTAGCTACAGACAAGGATAAGTTGTCTTATAGCATTGGTGCCGATTTGGGGAAGAATTTTA
AAAATCAAGGCATAGATGTTAATCCGGAAGCAATGGCTAAAGGCATGCAAGACGCTATGAGTGGCGCTCA
ATTGGCTTTAACCGAACAGCAAATGAAAGACGTTCTTAACAAGTTTCAGAAAGATTTGATGGCAAAGCGT
ACTGCTGAATTCAATAAGAAAGCGGATGAAAATAAAGTAAAAGGGGAAGCCTTTTTAACTGAAAACAAAA
ACAAGCCAGGCGTTGTTGTATTGCCAAGTGGTTTGCAATACAAAGTAATCAATGCTGGAAATGGTGTTAA
ACCCGGTAAATCCGATACAGTCACTGTCGAATACACTGGTCGTCTGATTGATGGTACCGTTTTTGACAGT
ACCGAAAAAACTGGTAAGCCAGCAACTTTTCAGGTTTCACAAGTTATCCCAGGATGGACTGAAGCTTTGC
AATTGATGCCAGCTGGATCAACCTGGGAAATTTATGTTCCATCAGGTCTTGCATATGGCCCACGTAGCGT
TGGCGGACCTATTGGCCCAAATGAAACTTTAATATTTAAAATTCACTTAATTTCAGTGAAAAAATCATCT
TA
Protein Sequence
>gi|54293773|ref|YP_126188.1| macrophage infectivity potentiator [Legionella pneumophila str. Lens] MKMKLVTAAVMGLAMSTAMAATDATSLATDKDKLSYSIGADLGKNFKNQGIDVNPEAMAKGMQDAMSGAQLALTEQQMKDVLNKFQKDLMAKRTAEFNKKADENKVKGEAFLTENKNKPGVVVLPSGLQYKVINAGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKKSS
Molecule Role Virulence factor
Molecule Role Annotation MUTATION: mip mutants are approximately 50- to 100-fold less infective for A. castellanii and for human mononuclear phagocytes in vitro compared with their isogenic Mip-positive parental strains (Wintermeyer et al., 1995).
COG COG0545O, under O: Posttranslational modification, protein turnover, chaperones
References
Wintermeyer et al., 1995: Wintermeyer E, Ludwig B, Steinert M, Schmidt B, Fischer G, Hacker J. Influence of site specifically altered Mip proteins on intracellular survival of Legionella pneumophila in eukaryotic cells. Infection and immunity. 1995; 63(12); 4576-4583. [PubMed: 7591108].