Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

fur from Legionella pneumophila str. Lens

Victor ID 1460
Gene Name fur from Legionella pneumophila str. Lens
Sequence Strain (Species/Organism) Legionella pneumophila str. Lens
NCBI Gene ID 3114575
NCBI Protein GI 54293365
Locus Tag lpl0414
Protein Accession YP_125780.1
Other Database IDs UniProtKB-ID: Q5WZG8_LEGPL
UniRef100: UniRef100_Q48835
UniRef90: UniRef90_Q48835
UniRef50: UniRef50_Q48835
UniParc: UPI000012AD80
EMBL: CR628337
EMBL-CDS: CAH14644.1
RefSeq_NT: NC_006369.1
GenomeReviews: CR628337_GR
KEGG: lpf:lpl0414
LegioList: lpl0414
eggNOG: COG0735
HOGENOM: HBG731501
OMA: YGVCTND
ProtClustDB: CLSK914682
BioCyc: LPNE297245:LPL0414-MONOMER
Taxonomy ID 297245
Gene Starting Position 460262
Gene Ending Position 460672
Gene Strand (Orientation) +
Protein Name Ferric uptake regulation protein
DNA Sequence
>gi|54292964:460262-460672 Legionella pneumophila str. Lens, complete genome
AGTGGAAGAGAGTCAACAGTTAAAAGACGCTGGATTAAAAATCACATTACCTCGTATCAAGGTATTGCAA
ATATTGGAGCAATCAAGAAACCATCATTTGAGTGCAGAAGCAGTCTATAAAGCCTTATTGGAATCGGGTG
AGGATGTTGGTTTAGCTACTGTGTATAGAGTTCTTACTCAATTTGAAGCAGCGGGATTAGTATCGAGACA
TAATTTTGAAGGAGGACACTCGGTGTTTGAGTTGTCTCAAGGCGAACATCATGACCATCTTGTTTGTGTT
AAGTGTGGGCGGGTAGAGGAATTTGTAGATGAAATAATAGAACAAAGACAAAAAGCAATTGCCGAACGCG
CTCATTTTAAAATGACAGATCATGCGCTAAACATATATGGTATATGTCCGCAGTGTCAATG
Protein Sequence
>gi|54293365|ref|YP_125780.1| ferric uptake regulation protein [Legionella pneumophila str. Lens] MEESQQLKDAGLKITLPRIKVLQILEQSRNHHLSAEAVYKALLESGEDVGLATVYRVLTQFEAAGLVSRHNFEGGHSVFELSQGEHHDHLVCVKCGRVEEFVDEIIEQRQKAIAERAHFKMTDHALNIYGICPQCQ
Molecule Role Virulence factor
Molecule Role Annotation MUTATION: fur mutant has attenuated intracellular growth within U937 cell monolayers (Robey and Cianciotto, 2002).
COG COG0735P, under P: Inorganic ion transport and metabolism
References
Robey and Cianciotto, 2002: Robey M, Cianciotto NP. Legionella pneumophila feoAB promotes ferrous iron uptake and intracellular infection. Infection and immunity. 2002; 70(10); 5659-5669. [PubMed: 12228295].