Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

iraA from Legionella pneumophila str. Lens

Victor ID 1463
Gene Name iraA from Legionella pneumophila str. Lens
Sequence Strain (Species/Organism) Legionella pneumophila str. Lens
NCBI Gene ID 3114746
NCBI Protein GI 54293731
Locus Tag lpl0784
Protein Accession YP_126146.1
Other Database IDs UniProtKB-ID: Q5WYF2_LEGPL
UniRef100: UniRef100_A5IGG0
UniRef90: UniRef90_A5IGG0
UniRef50: UniRef50_A5IGG0
UniParc: UPI00000BEBD5
EMBL: CR628337
EMBL-CDS: CAH15018.1
RefSeq_NT: NC_006369.1
GenomeReviews: CR628337_GR
KEGG: lpf:lpl0784
LegioList: lpl0784
HOGENOM: HBG111510
ProtClustDB: CLSK832375
BioCyc: LPNE297245:LPL0784-MONOMER
Taxonomy ID 297245
Gene Starting Position 890991
Gene Ending Position 891809
Gene Strand (Orientation) -
Protein Name small-molecule methyltransferase IraA
DNA Sequence
>gi|54292964:890991-891809 Legionella pneumophila str. Lens, complete genome
ATCACTTCCTGGCAAGAACTACATCAATAATATGAGTGTCATGGTAGGGAAAAGTAAAGATTTTGCTGAA
AAGTCGTTTAAGACGCTGAATTAAAAAATATTTTGGCAGCATGCGTATTGATAGAGTGTTAAGAAACCAG
GTGCCTTCTATTCCAAACAGTGCCAATTCATCAATGTTATTAAGGGTAATGGGTATTTCAATACGTTGGT
GATCCAAAATATTGAATTGATGCTGTTTAAATGCCAGCAAGAGTTCATCGAGATTTGCAGCAACAGTTGT
ATTTTTGACTATGGATTTATAGTAGTGACCAACAACTCGACTTAAAATAGTATCCTGAGCAATGAAGTTG
GCCAGTTGTTGTTGCGCTACAGGAAAAGAATCATAGGTCGTTGTGATTAAAGAGAAGTGACCGTTGGCGC
GCGTCAAGTATTTGGCTTCATCAAAGAGAACATTAATAGGGATATAAGCATTAATAAAATGAGCCAGAAC
CAAGTCCTGGCTATGTGCAGGCAAAAACTTGTTGGCTTCTGCAGCACTGCCTTCAATGGTTGTTAAAGGA
AGGGCTTCGCTCGCTCGTTTTAACATTTCTGATGAAACATCAATTCCTGTGAAATTAGCCATTGGCATTA
AGTGATGCAATTTTTGCAAAAAAGAACCATTGCCAACGCCCAGATCGAGGATTTTATAATGGGGTTTCAA
CCCCAAATGAAACTTCCTCATCTGCTCAATGGCAACGTGATGGCTTTCACTAATTGAACCAAAACGATTA
GCTGTCGCGTAATTTTCTGCGATTTGGTTATACATGGCCTTCAAGGACA
Protein Sequence
>gi|54293731|ref|YP_126146.1| small-molecule methyltransferase IraA [Legionella pneumophila str. Lens] MSLKAMYNQIAENYATANRFGSISESHHVAIEQMRKFHLGLKPHYKILDLGVGNGSFLQKLHHLMPMANFTGIDVSSEMLKRASEALPLTTIEGSAAEANKFLPAHSQDLVLAHFINAYIPINVLFDEAKYLTRANGHFSLITTTYDSFPVAQQQLANFIAQDTILSRVVGHYYKSIVKNTTVAANLDELLLAFKQHQFNILDHQRIEIPITLNNIDELALFGIEGTWFLNTLSIRMLPKYFLIQRLKRLFSKIFTFPYHDTHIIDVVLARK
Molecule Role Virulence factor
Molecule Role Annotation MUTATION: iraA mutant is attenuated in guinea pigs (Viswanathan et al., 2000).
COG COG2226H, under H: Coenzyme transport and metabolism
References
Viswanathan et al., 2000: Viswanathan VK, Edelstein PH, Pope CD, Cianciotto NP. The Legionella pneumophila iraAB locus is required for iron assimilation, intracellular infection, and virulence. Infection and immunity. 2000; 68(3); 1069-1079. [PubMed: 10678909].