Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

cpxR from Legionella pneumophila str. Lens

Victor ID 1466
Gene Name cpxR from Legionella pneumophila str. Lens
Sequence Strain (Species/Organism) Legionella pneumophila str. Lens
NCBI Gene ID 3115566
NCBI Protein GI 54294527
Locus Tag lpl1603
Protein Accession YP_126942.1
Other Database IDs UniProtKB-ID: Q5WW57_LEGPL
UniRef100: UniRef100_Q5WW57
UniRef90: UniRef90_D3HTB6
UniRef50: UniRef50_A9FFH2
UniParc: UPI00001B67A3
EMBL: CR628337
EMBL-CDS: CAH15843.1
RefSeq_NT: NC_006369.1
GenomeReviews: CR628337_GR
KEGG: lpf:lpl1603
LegioList: lpl1603
eggNOG: NOG118951
HOGENOM: HBG753323
OMA: THSQANE
ProtClustDB: CLSK832796
BioCyc: LPNE297245:LPL1603-MONOMER
Taxonomy ID 297245
Gene Starting Position 1777460
Gene Ending Position 1778140
Gene Strand (Orientation) +
Protein Name transcriptional regulatory protein CpxR
DNA Sequence
>gi|54292964:1777460-1778140 Legionella pneumophila str. Lens, complete genome
CATGAGCAGCTCTATTCTCATTATTGATGATGACACAGAACTAACAGATTTATTAACCCAATATTTGGAA
CCAGAAGGCTTTAATGTAGTATGTGTGCATGATGGAGAAAATGGCGTTAAAAGAGCTTTAAATCAGGTAT
TTGATGCCATTATACTCGACGTCATGCTGCCTAAGCTTAATGGTTTTGAAGTATTAAAGGCAATAAGAGA
GCATTTGGAAACACCTGTATTGATGTTAACTGCTCGTGGTGATGATATCGATCGCATTGTTGGGTTAGAA
ATTGGGGCAGATGATTACTTACCTAAACCTTGTAATCCACGAGAGTTAGTTGCACGTCTGCGTGCTATTT
TAAGACGCACTCAAAAAATCCCAACTCCCAAACCTATTATTGAACAACATAATATCATTGTGGATTGCTC
CAAACGCCACGTGACTATGGGAGGAAAGTTCCTTGAATTAACCAATGCGGAATTTAATATTTTGGAGATG
TTAATCAAATCACCAGGGCAAGCATTTTCCAAAGAGGAACTCACTGAATATGCTCTGGGAAGAAAATACA
CTGCTTATGACCGCAGTATCGATGTTCACATCAGCAATTTGCGAAATAAATTAGGCGATAATCCTCAGGG
AGAACCTTTAGTCAAAACAGTCCGCGGGTTTGGGTACATGTTTAATGCGTA
Protein Sequence
>gi|54294527|ref|YP_126942.1| transcriptional regulatory protein CpxR [Legionella pneumophila str. Lens] MSSSILIIDDDTELTDLLTQYLEPEGFNVVCVHDGENGVKRALNQVFDAIILDVMLPKLNGFEVLKAIREHLETPVLMLTARGDDIDRIVGLEIGADDYLPKPCNPRELVARLRAILRRTQKIPTPKPIIEQHNIIVDCSKRHVTMGGKFLELTNAEFNILEMLIKSPGQAFSKEELTEYALGRKYTAYDRSIDVHISNLRNKLGDNPQGEPLVKTVRGFGYMFNA
Molecule Role Virulence factor
Molecule Role Annotation MUTATION: cpxR mutant is attenuated in mouse macrophages (Vincent et al., 2006).
COG COG0745TK, under T: Signal transduction mechanisms; K: Transcription
References
Vincent et al., 2006: Vincent CD, Buscher BA, Friedman JR, Williams LA, Bardill P, Vogel JP. Identification of non-dot/icm suppressors of the Legionella pneumophila DeltadotL lethality phenotype. Journal of bacteriology. 2006; 188(23); 8231-8243. [PubMed: 16997951].