Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

iraA from Legionella pneumophila str. Paris

Victor ID 1469
Gene Name iraA from Legionella pneumophila str. Paris
Sequence Strain (Species/Organism) Legionella pneumophila str. Paris
NCBI Gene ID 3116645
NCBI Protein GI 54296774
Locus Tag lpp0813
Protein Accession YP_123143.1
Other Database IDs UniProtKB-ID: Q5X700_LEGPA
UniRef100: UniRef100_A5IGG0
UniRef90: UniRef90_A5IGG0
UniRef50: UniRef50_A5IGG0
UniParc: UPI00000BEBD5
EMBL: CR628336
EMBL-CDS: CAH11961.1
RefSeq_NT: NC_006368.1
GenomeReviews: CR628336_GR
KEGG: lpp:lpp0813
LegioList: lpp0813
HOGENOM: HBG111510
ProtClustDB: CLSK832375
BioCyc: LPNE297246:LPP0813-MONOMER
Taxonomy ID 297246
Gene Starting Position 911036
Gene Ending Position 911854
Gene Strand (Orientation) -
Protein Name small-molecule methyltransferase IraA
DNA Sequence
>gi|54295983:911036-911854 Legionella pneumophila str. Paris, complete genome
ATCACTTCCTGGCAAGAACTACATCAATAATATGAGTGTCATGGTAGGGAAAAGTAAAGATTTTGCTGAA
AAGTCGTTTAAGACGCTGAATTAAAAAATATTTTGGCAGCATGCGTATCGATAGAGTGTTAAGAAACCAG
GTGCCTTCTATTCCAAACAGTGCCAATTCATCAATGTTATTAAGGGTAATGGGTATTTCAATACGTTGGT
GATCCAAAATATTAAATTGATGCTGTTTAAATGCCAGCAAGAGTTCATCGAGATTTGCAGCAACAGTTGT
ATTTTTGACTATGGATTTATAGTAGTGACCAACAACTCGACTTAAAATAGTATCCTGAGCAATGAAGTTG
GCCAGTTGTTGTTGCGCTACAGGAAAAGAATCATAGGTCGTTGTGATTAAAGAGAAGTGACCATTGGCAC
GCGTCAAGTATTTGGCTTCATCAAAGAGAACATTAATAGGGATATATGCATTAATAAAATGAGCCAGAAC
CAAGTCCTGGCTATGTGCGGGCAAAAACTTGTTGGCTTCTGCAGCACTGCCTTCAATGGTTGTTAAAGGA
AGGGCTTCGCTCGCTCGTTTCAACATTTCTGATGAAACATCAATTCCTGTGAAATTGGCCATTGGCATTA
AGTGATGCAATTTTTGCAAAAAAGAGCCATTGCCAACGCCCAGATCGAGGATTTTATAATGGGGTTTCAA
CCCCAAATGAAATTTCCTCATCTGCTCAATGGCAACGTGATGGCTTTCACTAATTGAACCAAAACGATTA
GCTGTCGCGTAATTTTCTGCGATTTGGTTATACATGGCCTTCAAGGACA
Protein Sequence
>gi|54296774|ref|YP_123143.1| small-molecule methyltransferase IraA [Legionella pneumophila str. Paris] MSLKAMYNQIAENYATANRFGSISESHHVAIEQMRKFHLGLKPHYKILDLGVGNGSFLQKLHHLMPMANFTGIDVSSEMLKRASEALPLTTIEGSAAEANKFLPAHSQDLVLAHFINAYIPINVLFDEAKYLTRANGHFSLITTTYDSFPVAQQQLANFIAQDTILSRVVGHYYKSIVKNTTVAANLDELLLAFKQHQFNILDHQRIEIPITLNNIDELALFGIEGTWFLNTLSIRMLPKYFLIQRLKRLFSKIFTFPYHDTHIIDVVLARK
Molecule Role Virulence factor
Molecule Role Annotation MUTATION: iraA mutant is attenuated in guinea pigs (Viswanathan et al., 2000).
COG COG2226H, under H: Coenzyme transport and metabolism
References
Viswanathan et al., 2000: Viswanathan VK, Edelstein PH, Pope CD, Cianciotto NP. The Legionella pneumophila iraAB locus is required for iron assimilation, intracellular infection, and virulence. Infection and immunity. 2000; 68(3); 1069-1079. [PubMed: 10678909].