Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

rpoS from Legionella pneumophila str. Paris

Victor ID 1471
Gene Name rpoS from Legionella pneumophila str. Paris
Sequence Strain (Species/Organism) Legionella pneumophila str. Paris
NCBI Gene ID 3117391
NCBI Protein GI 54297202
Locus Tag lpp1247
Protein Accession YP_123571.1
Other Database IDs UniProtKB-ID: Q5X5S3_LEGPA
UniRef100: UniRef100_Q5WX51
UniRef90: UniRef90_Q5ZW04
UniRef50: UniRef50_P35540
UniParc: UPI0000444D10
EMBL: CR628336
EMBL-CDS: CAH12398.1
RefSeq_NT: NC_006368.1
GenomeReviews: CR628336_GR
KEGG: lpp:lpp1247
LegioList: lpp1247
eggNOG: COG0568
HOGENOM: HBG745096
OMA: NMENLFN
ProtClustDB: CLSK832699
BioCyc: LPNE297246:LPP1247-MONOMER
Taxonomy ID 297246
Gene Starting Position 1384358
Gene Ending Position 1385383
Gene Strand (Orientation) +
Protein Name RNA polymerase sigma factor RpoS
DNA Sequence
>gi|54295983:1384358-1385383 Legionella pneumophila str. Paris, complete genome
AATGCAAGATGAAGAAGAGCCAATTAAGGACAAGGAATTTAAAGAAGAGGAATGGTCTGAGCCAGATGAT
GACTCTCTGTTGTCAGAAGAGGATATTGAACCTGATATTGAAAAAATGGAAGAAGAGCTTGATGAACTTC
CAGAGTTTACTGATGATGAAGCTTTTCCTTCATTCCAGCGCGGGAAAAATATTGCCAAGGCTTTAGATGC
GACTCAACTTTACTTGGGTGAAATTGGTTTTTCTCCTTTGCTAACGGCTGAAGAAGAAATCCATTATGCG
ACTCTTGCTTTAAAAGGTGATATGGAAGCACGCAAGAAAATGATTGAGTCGAATTTGCGCCTGGTGGTTA
AAATAGCCAGACGCTATCTTAATAGAGGATTACCTCTTCTGGATCTAATCGAAGAGGGTAACCTGGGTTT
AATGAAGTCTGTTGAGAAATTTGACCCCAAGCGAGGATTCCGTTTTTCAACTTATGCGACCTGGTGGATT
AGGCAAACTATTGAGCGCGCAATTATGAATCAAACGAGAACTATCCGCTTGCCTATTCATGTCGTGAAAG
AACTTAATGTTTATCTCAGAGCGGCAAGACAATTGACGCAAAAACTGGATCATGAACCATCACCTGAAGA
AATAGCAGAAATGGTGGATAAGCCTTTGGAGGATGTCCAAAAATTATTGGGATTGAATGATAAAGTCGCT
TCAGTTGATACTCCAATTGGATTTGATGAAACCAAATCTTTATTAGATACAATTGCTGATGAAAACAGTT
TAAATCCTGCAGAGCTGCTAACCAATGAGAATTTAAGGCAGCATATAGAATCTCTTCTGGATAAATTAAC
TGAGAATCAACAGCAGGTTATCGCAAGACGTTTTGGGTTAAGAGGTTTTGAAAAAGCGACACTGGAAGAC
GTTGGTAAGGAAATTGATTTGACCCGAGAACGCGTTCGCCAAATTCAAGTTGAAGCTTTGAAGACACTTA
GAACTTTGTTAGAGCGGGTTGGACTAACACAAGAGGATTTGTTTTG
Protein Sequence
>gi|54297202|ref|YP_123571.1| RNA polymerase sigma factor RpoS [Legionella pneumophila str. Paris] MQDEEEPIKDKEFKEEEWSEPDDDSLLSEEDIEPDIEKMEEELDELPEFTDDEAFPSFQRGKNIAKALDATQLYLGEIGFSPLLTAEEEIHYATLALKGDMEARKKMIESNLRLVVKIARRYLNRGLPLLDLIEEGNLGLMKSVEKFDPKRGFRFSTYATWWIRQTIERAIMNQTRTIRLPIHVVKELNVYLRAARQLTQKLDHEPSPEEIAEMVDKPLEDVQKLLGLNDKVASVDTPIGFDETKSLLDTIADENSLNPAELLTNENLRQHIESLLDKLTENQQQVIARRFGLRGFEKATLEDVGKEIDLTRERVRQIQVEALKTLRTLLERVGLTQEDLF
Molecule Role Virulence factor
Molecule Role Annotation MUTATION: rpoS mutant has defective intracellular replication in its protozoan host (Hovel-Miner et al., 2009).
COG COG0568K, under K: Transcription
References
Hovel-Miner et al., 2009: Hovel-Miner G, Pampou S, Faucher SP, Clarke M, Morozova I, Morozov P, Russo JJ, Shuman HA, Kalachikov S. SigmaS controls multiple pathways associated with intracellular multiplication of Legionella pneumophila. Journal of bacteriology. 2009; 191(8); 2461-2473. [PubMed: 19218380].