Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

rtxA-1

Victor ID 1472
Gene Name rtxA-1
Sequence Strain (Species/Organism) Legionella pneumophila str. Paris
NCBI Gene ID 3117483
NCBI Protein GI 54296668
Locus Tag lpp0699
Genbank Accession CR628336
Protein Accession YP_123037
Other Database IDs UniProtKB-ID: Q5X7A6_LEGPA
UniRef100: UniRef100_Q5X7A6
UniRef90: UniRef90_Q5X7A6
UniRef50: UniRef50_Q5X7A6
UniParc: UPI0000445E01
EMBL: CR628336
EMBL-CDS: CAH11847.1
RefSeq_NT: NC_006368.1
GenomeReviews: CR628336_GR
KEGG: lpp:lpp0699
LegioList: lpp0699
eggNOG: COG2931
HOGENOM: HBG520014
ProtClustDB: CLSK834505
BioCyc: LPNE297246:LPP0699-MONOMER
Taxonomy ID 297246
Gene Starting Position 753772
Gene Ending Position 776851
Gene Strand (Orientation) +
Protein Name structural toxin protein RtxA
Protein pI 3.95
Protein Weight 735510.56
Protein Length 7679
DNA Sequence
>gi|54295983:753772-776851 Legionella pneumophila str. Paris, complete genome
CATGTTAGCTGAATCTGTTATCGGTATAGTAAGAGCCGTCAATGGACTGCTTGAAAAAGTAAACGCACAA
GGACAAGCAAGCCTGGTAAAGTCAGGTGCTCGACTACAGGAAGGGGATGTACTTACTCTATTAAGTGGTG
AAGCCTATATACAGTTTATCCATGGATTTCCTGAAGCACTGGCTTTGGGAAAACCTGTCAATTTGTATGG
TGTTTCACCGGCATTGCAGTACGGCGTGGAAGAACTCAATGAACAACTGGTCCAGGAAGCGCTAGCCAAA
GGTATTGATCCTTCAGTCATACTTGATGTTCTTGGCTCAGCAGCAGCAGGTGCCGAGGCGGTGGGATCAG
GAGGCGATGCATTTATTATGGATCCTTTGTTTGGCTTCGGACATGTCACAGCAGGATATCCCACCGGACC
TATTTCCTTTGCTTATGAGGCAGACACTCAGCAATTATTTTGGTTTGTGCCAGAAGAGACAGGGGTGATT
GCAGAATCCGAATTGACTCAAGAGCCTGAATCTATCCCGCAAATTCCTCAATTCACCACAAATCAAGCAG
TGCTAACAGTTTTTGAGGATGCTTTGCCAAGTGGCATTGCTGATTCAGCAGGACAAGCAAGAATAGCAAG
TTCTTCTTTAAGTTCTTTGCTCACCTCTTCAGCAGACGTTGCTGCTTCCTTTGCTTTTAATAGCAATTTA
AGTGCTCTTCCTACATTAAAATCAGGTGGTATAGACCTTAGTTATGAATTATCCGCTGATAAACGTACCT
TAACCTTAAGAGAATCAAACACTCAAGGGCCAGGGGCAGAGGTCATGAAATTTGAGCTGACAGCAGATGG
GCAGTTAACTCAAACACTAATGAATTCAATTGATCACCCAACAGCTGATAGCGATGACGGCGAGTGGATG
AGATTAGACCTTTCACCTTTAATTGATGTGACTTTCACAAGAACAATTGATGGCAGTGTTTTAGAGTCAA
GAACACTACCTGCTAATGCAGTTGTTGCAGGAATTCAAGACGATGTTCCAATAGCAAGGGCTCAATTGAC
CAATAATGAAATCCTGCTGGATGAAACTATAGGAATGAAAGTCGGTGATGTTGATGCAGCTAATGATGAT
TTTAATCCAACGACCACTGCGGATCCTTTTAATAATACTTATGGTATACCCATAGGTCTAGTGCAAAATG
CGAATCTCCTTGATACCAGTACTTCTGAAATGGGGGGGGATTATAAAAATGCAACAATGACCCATTTGAT
AAAAATTACCGATGCTGTTTCAGGATTACAGACAACTGACGGCACTCCTGTCAATCTCTTTTTGGAATCC
AATGGTGATATTAGCGGAAGAGCAGGTGACATTGGTGCTCCTGCAGTTTTTGCAATTCGCATGAATCCAA
ATACTGGTGCAATTACCGTTGCACAGTATGGTTCAATTAAACAATTTGATACCAACAGCTATGATGAAGC
GGTTGACTTGACTGGGCGCATTTCAGTTGTAGTTACAGCCAAAGACAGTGATGGTGACGTATCTAACGCA
GAAATACCGATAGGACAATTGATCATTTTTGAAGACGACGGCCCTGTGGTTGATATGGCGGTGAAGGCAG
GGGCTGCCTTGACGCTTGATGAAACGAAAGGAGTGAAAGCCGGCGATGCGAATGCGAACGACGAAGCGGC
ATCTGCTGATGCCAATGACATTGGTTATGCGAAGCTTGTCGGCAGTGATTTGTTTACTTTAACGAAAGAC
GCAGGCTCTGACGGGGANCAATCCACCCTCTTTAAGCTTTTGGTGNGTGCTCCGGCTTCTGGTTTGGTGG
ATACGGCAACCAANCAGGCCATCGTGTTGTCTGCCAATGCGGGCGGNACGGAAGTGTTGGGCAAGAACAC
CAATGGGGATGTGGTGTTTAAGGTTTTATTAACTGCCAGCNATGGGGATGTGGAAGTCTTTCAATACCGT
GCGATCAAACACGAGAATGCCAGCGACCACGACGAATCCGGCGCGGGAGGCATAATAGAGCGCATTCAAG
CCGGCTCTTTGAAATTGGAAGTGACNTTAACCGACAAAGACGGCGACAGTGCGAAAGNCGANCTGGATTT
GGGTCAAATGATGCGCTTTGAAGACGACGGCCCTGTGGTTGATATGGCGGTGAAGGCAGGGGCTGCCTTG
ACGCTTGATGAAACGAAAGGAGTGAAAGCCGGCGATGCGAATGCGAACGACGAAGCGGCTTCTGCCGATG
CCAATGACATTGGTTATGCGAAGCTTGTCGGCAGTGATTTGTTTACTTTAACGAAAGACGCAGGCTCTGA
CGGGGAGCAATCCACCCTCTTTAAGCTTTTGGTGAGTGCTCCGGCTTCTGGTTTGGTGGATACGGCAACC
AATCAGGCCATCGTGTTGTCTGCCAATGCGGGCGGCACGGAAGTGTTGGGCAAGAACACCAATGGGGATG
TGGTGTTTAAGGTTTTATTAACTGCCAGCAATGGGGATGTGGAAGTCTTTCAATACCGTGCGATCAAACA
CGAGAATGCCAGCGACCACGACGAATCCGGCGCGGGAGGCATAATAGAGCGCATTCAAGCCGGCTCTTTG
AAATTGGAAGTGACCTTAACCGACAAAGACGGCGACAGTGCGAAAGACGACCTGGATTTGGGTCAAATGA
TGCGCTTTGAAGACGACGGCCCTGTGGTTGATATGGCGGTGAAGGCAGGGGCTGCCTTGACGCTTGATGA
AACGCAAGGGATGAAAGCCGGCGATGCGAATGCGAACGACGAAGCGGCATCTGCTGATGCCAATGACATT
GGTTATGCGAAGCTTGTCGGCAGTGATTTGTTTACTTTAACGAAAGACGCAGGCTCTGACGGGGAGCAAT
CCACCCTCTTTAAGCTTTTGGTGAGTGCTCCGGCTTCTGGTTTGGTGGATACGGCAACCAATCAGGCCAT
CGTGTTGTCTGCCAATGCGGGCGGCACGGAAGTGTTGGGCAAGAACACCAATGGGGATGTGGTGTTTAAG
GTTTTATTAACTGCCAGCAATGGGGATGTGGAAGTCTTTCAATACCGTGCGATCAAACACGAGAATGCCA
GCGACCACGACGAATCCGGCGCGGGAGGCATAATAGAGCGCATTCAAGCCGGCTCTTTGAAATTGGAAGT
GACCTTAACCGACAAAGACGGCGACAGTGCGAAAGACGACCTGGATTTGGGTCAAATGATGCGCTTTGAA
GACGACGGCCCTGTGGTTGATATGGCGGTGAAGGCAGGGGCTGCCTTGACGCTTGATGAAACGCAAGGGA
TGAAAGCCGGCGATGCGAATGCGAACGACGAAGCGGCATCTGCTGATGCCAATGACATTGGTTATGCGAA
GCTTGTCGGCAGTGATTTGTTTACTTTAACGAAAGACGCAGGCTCTGACGGGGAGCAATCCACCCTCTTT
AAGCTTTTGGTGGGTGCTCCGGCTTCTGGTTTGGTGGATACGGCAACCAACCAGGCCATCGTGTTGTCTG
CCAATGCGGGCGGTACGGAAGTGTTGGGCAAGAACACCAATGGGGATGTGGTGTTTAAGGTTTTATTAAC
TGCCAGCAATGGGGATGTGGAAGTCTTTCAATACCGTGCGATCAAACACGAGAATGCCAGCGACCACGAC
GAATCCGGCGCGGGAGGCATAATAGAGCGCATTCAAGCCGGCTCTTTGAAATTGGAAGTGACCTTAACCG
ACAAAGACGGCGACAGTGCGAAAGACGACCTGGATTTGGGTCAAATGATGCGCTTTGAAGACGACGGCCC
TGTGGTTGATATGGCGGTGAAGGCAGGGGCTGCCTTGACGCTTGATGAAACGAAAGGAGTGAAAGCCGGC
GATGCGAATGCGAACGACGAAGCGGCTTCTGCCGATGCCAATGACATTGGTTATGCGAAGCTTGTCGGCA
GTGATTTGTTTACTTTAACGAAAGACGCAGGCTCTGACGGGGAGCAATCCACCCTCTTTAAGCTTTTGGT
GAGTGCTCCGGCTTCTGGTTTGGTGGATACGGCAACCAATCAGGCCATCGTGTTGTCTGCCAATGCGGGC
GGCACGGAAGTGTTGGGCAAGAACACCAATGGGGATGTGGTGTTTAAGGTTTTATTAACTGCCAGCAATG
GGGATGTGGAAGTCTTTCAATACCGTGCGATCAAACACGAGAATGCCAGCGACCACGACGAATCCGGCGC
GGGAGGCATAATAGAGCGCATTCAAGCCGGCTCTTTGAAATTGGAAGTGACCTTAACCGACAAAGACGGC
GACAGTGCGAAAGGCGAGCTGGATTTGGGTCAAATGATGCGCTTTGAAGACGACGGCCCTGTGGTTGATA
TGGCGGTGAAGGCAGGGGCTGCCTTGACGCTTGATGAAACGAAAGGAGTGAAAGCCGGCGATGCGAATGC
GAACGACGAAGCGGCTTCTGCTGATGCCAATGACATTGGTTATGCGAAGCTTGTCGGCAGTGATTTGTTT
ACTTTAACGAAAGACGCAGGCTCTGACGGGGAGCAATCCACCCTCTTTAAGCTTTTGGTGAGTGCTCCGG
CTTCTGGTTTGGTGGATACGGCAACCAACCAGGCCATCGTGTTGTCTGCCAATGCGGGCGGCACGGAAGT
GTTGGGCAAGAACACCAATGGGGATGTGGTGTTTAAGGTTTTATTAACTGCCAGCAATGGGGATGTGGAA
GTCTTTCAATACCGTGCGATCAAACACGAGAATGCCAGCGACCACGACGAATCCGGCGCGGGAGGCATAA
TAGAGCGCATTCAAGCCGGCTCTTTGAAATTGGAAGTGACCTTAACCGACAAAGACGGCGACAGTGCGAA
AGACGACCTGGATTTGGGTCAAATGATGCGCTTTGAAGACGACGGCCCTGTGGTTGATATGGCGGTGAAG
GCAGGGGCTGCCTTGACGCTTGATGAAACGAAAGGAGTGAAAGCCGGCGATGCGAATGCGAACGACGAAG
CGGCATCTGCTGATGCCAATGACATTGGTTATGCGAAGCTTGTCGGCAGTGATTTGTTTACTTTAACGAA
AGACGCAGGCTCTGACGGGGAGCAATCCACCCTCTTTAAGCTTTTGGTGAGTGCTCCGGCTTCTGGTTTG
GTGGATACGGCAACCAATCAGGCCATCGTGTTGTCTGCCAATGCGGGCGGCACGGAAGTGTTGGGCAAGA
ACACCAATGGGGATGTGGTGTTTAAGGTTTTATTAACTGCCAGCAATGGGGATGTGGAAGTCTTTCAATA
CCGTGCGATCAAACACGAGAATGCCAGCGACCACGACGAATCCGGCGCGGGAGGCATAATAGAGCGCATT
CAAGCCGGCTCTTTGAAATTGGAAGTGACCTTAACCGACAAAGACGGCGACAGTGCGAAAGACGACCTGG
ATTTGGGTCAAATGATGCGCTTTGAAGACGACGGCCCTGTGGTTGATATGGCGGTGAAGGCAGGGGCTGC
CTTGACGCTTGATGAAACGAAAGGAGTGAAAGCCGGCGATGCGAATGCGAACGACGAAGCGGCTTCTGCC
GATGCCAATGACATTGGTTATGCGAAGCTTGTCGGCAGTGATTTGTTTACTTTAACGAAAGACGCAGGCT
CTGACGGGGAGCAATCCACCCTCTTTAAGCTTTTGGTGAGTGCTCCGGCTTCTGGTTTGGTGGATACGGC
AACCAATCAGGCCATCGTGTTGTCTGCCAATGCGGGCGGCACGGAAGTGTTGGGCAAGAACACCAATGGG
GATGTGGTGTTTAAGGTTTTATTAACTGCCAGCAATGGGGATGTGGAAGTCTTTCAATACCGTGCGATCA
AACACGAGAATGCCAGCGACCACGACGAATCCGGCGCGGGAGGCATAATAGAGCGCATTCAAGCCGGCTC
TTTGAAATTGGAAGTGACCTTAACCGACAAAGACGGCGACAGTGCGAAAGGCGAGCTGGATTTGGGTCAA
ATGATGCGCTTTGAAGACGACGGCCCTGTGGTTGATATGGCGGTGAAGGCAGGGGCTGCCTTGACGCTTG
ATGAAACGAAAGGAGTGAAAGCCGGCGATGCGAATGCGAACGACGAAGCGGCTTCTGCTGATGCCAATGA
CATTGGTTATGCGAAGCTTGTCGGCAGTGATTTGTTTACTTTAACGAAAGACGCAGGCTCTGACGGGGAN
CAATCCACCCTCTTTAAGCTTTTGGTGNGTGCTCCGGCTTCTGGTTTGGTGGATACGGCAACCAANCAGG
CCATCGTGTTGTCTGCCAATGCGGGCGGNACGGAAGTGTTGGGCAAGAACACCAATGGGGATGTGGTGTT
TAAGGTTTTATTAACTGCCAGCNATGGGGATGTGGAAGTCTTTCAATACCGTGCGATCAAACACGAGAAT
GCCAGCGACCACGACGAATCCGGCGCGGGAGGCATAATAGAGCGCATTCAAGCCGGCTCTTTGAAATTGG
AAGTGACNTTAACCGACAAAGACGGCGACAGTGCGAAAGNCGANCTGGATTTGGGTCAAATGATGCGCTT
TGAAGACGACGGCCCTGTGGTTGATATGGCGGTGAAGGCAGGGGCTGCCTTGACGCTTGATGAAACGNAA
GGNNTGAAAGCCGGCGATGCGAATGNGAACGACGAAGCGGCNTCTGCNGATGCCAATGACATTGGTTATG
CGAAGCTTGTCGGCAGTGATTTGTTTACTTTAACGAAAGACGCAGGCTCTGACGGGGANCAATCCACCCT
CTTTAAGCTTTTGGTGNGTGCTCCGGCTTCTGGTTTGGTGGATACGGCAACCAANCAGGCCATCGTGTTG
TCTGCCAATGCGGGCGGNACGGAAGTGTTGGGCAAGAACACCAATGGGGATGTGGTGTTTAAGGTTTTAT
TAACTGCCAGCNATGGGGATGTGGAAGTCTTTCAATACCGTGCGATCAAACACGAGAATGCCAGCGACCA
CGACGAATCCGGCGCGGGAGGCATAATAGAGCGCATTCAAGCCGGCTCTTTGAAATTGGAAGTGACNTTA
ACCGACAAAGACGGCGACAGTGCGAAAGNCGANCTGGATTTGGGTCAAATGATGCGCTTTGAAGACGACG
GCCCTGTGGTTGATATGGCGGTGAAGGCAGGGGCTGCCTTGACGCTTGATGAAACGNAAGGNNTGAAAGC
CGGCGATGCGAATGNGAACGACGAAGCGGCNTCTGCNGATGCCAATGACATTGGTTATGCGAAGCTTGTC
GGCAGTGATTTGTTTACTTTAACGAAAGACGCAGGCTCTGACGGGGANCAATCCACCCTCTTTAAGCTTT
TGGTGNGTGCTCCGGCTTCTGGTTTGGTGGATACGGCAACCAANCAGGCCATCGTGTTGTCTGCCAATGC
GGGCGGNACGGAAGTGTTGGGCAAGAACACCAATGGGGATGTGGTGTTTAAGGTTTTATTAACTGCCAGC
NATGGGGATGTGGAAGTCTTTCAATACCGTGCGATCAAACACGAGAATGCCAGCGACCACGACGAATCCG
GCGCGGGAGGCATAATAGAGCGCATTCAAGCCGGCTCTTTGAAATTGGAAGTGACNTTAACCGACAAAGA
CGGCGACAGTGCGAAAGNCGANCTGGATTTGGGTCAAATGATGCGCTTTGAAGACGACGGCCCTGTGGTT
GATATGGCGGTGAAGGCAGGGGCTGCCTTGACGCTTGATGAAACGNAAGGNNTGAAAGCCGGCGATGCGA
ATGNGAACGACGAAGCGGCNTCTGCNGATGCCAATGACATTGGTTATGCGAAGCTTGTCGGCAGTGATTT
GTTTACTTTAACGAAAGACGCAGGCTCTGACGGGGANCAATCCACCCTCTTTAAGCTTTTGGTGNGTGCT
CCGGCTTCTGGTTTGGTGGATACGGCAACCAANCAGGCCATCGTGTTGTCTGCCAATGCGGGCGGNACGG
AAGTGTTGGGCAAGAACACCAATGGGGATGTGGTGTTTAAGGTTTTATTAACTGCCAGCNATGGGGATGT
GGAAGTCTTTCAATACCGTGCGATCAAACACGAGAATGCCAGCGACCACGACGAATCCGGCGCGGGAGGC
ATAATAGAGCGCATTCAAGCCGGCTCTTTGAAATTGGAAGTGACNTTAACCGACAAAGACGGCGACAGTG
CGAAAGNCGANCTGGATTTGGGTCAAATGATGCGCTTTGAAGACGACGGCCCTGTGGTTGATATGGCGGT
GAAGGCAGGGGCTGCCTTGACGCTTGATGAAACGNAAGGNNTGAAAGCCGGCGATGCGAATGNGAACGAC
GAAGCGGCNTCTGCNGATGCCAATGACATTGGTTATGCGAAGCTTGTCGGCAGTGATTTGTTTACTTTAA
CGAAAGACGCAGGCTCTGACGGGGANCAATCCACCCTCTTTAAGCTTTTGGTGNGTGCTCCGGCTTCTGG
TTTGGTGGATACGGCAACCAANCAGGCCATCGTGTTGTCTGCCAATGCGGGCGGNACGGAAGTGTTGGGC
AAGAACACCAATGGGGATGTGGTGTTTAAGGTTTTATTAACTGCCAGCNATGGGGATGTGGAAGTCTTTC
AATACCGTGCGATCAAACACGAGAATGCCAGCGACCACGACGAATCCGGCGCGGGAGGCATAATAGAGCG
CATTCAAGCCGGCTCTTTGAAATTGGAAGTGACNTTAACCGACAAAGACGGCGACAGTGCGAAAGNCGAN
CTGGATTTGGGTCAAATGATGCGCTTTGAAGACGACGGCCCTGTGGTTGATATGGCGGTGAAGGCAGGGG
CTGCCTTGACGCTTGATGAAACGNAAGGNNTGAAAGCCGGCGATGCGAATGNGAACGACGAAGCGGCNTC
TGCNGATGCCAATGACATTGGTTATGCGAAGCTTGTCGGCAGTGATTTGTTTACTTTAACGAAAGACGCA
GGCTCTGACGGGGANCAATCCACCCTCTTTAAGCTTTTGGTGNGTGCTCCGGCTTCTGGTTTGGTGGATA
CGGCAACCAANCAGGCCATCGTGTTGTCTGCCAATGCGGGCGGNACGGAAGTGTTGGGCAAGAACACCAA
TGGGGATGTGGTGTTTAAGGTTTTATTAACTGCCAGCNATGGGGATGTGGAAGTCTTTCAATACCGTGCG
ATCAAACACGAGAATGCCAGCGACCACGACGAATCCGGCGCGGGAGGCATAATAGAGCGCATTCAAGCCG
GCTCTTTGAAATTGGAAGTGACNTTAACCGACAAAGACGGCGACAGTGCGAAAGNCGANCTGGATTTGGG
TCAAATGATGCGCTTTGAAGACGACGGCCCTGTGGTTGATATGGCGGTGAAGGCAGGGGCTGCCTTGACG
CTTGATGAAACGNAAGGNNTGAAAGCCGGCGATGCGAATGNGAACGACGAAGCGGCNTCTGCNGATGCCA
ATGACATTGGTTATGCGAAGCTTGTCGGCAGTGATTTGTTTACTTTAACGAAAGACGCAGGCTCTGACGG
GGAGCAATCCACCCTCTTTAAGCTTTTGGTGGGTGCTCCGGCTTCTGGTTTGGTGGATACGGCAACCAAT
CAGGCCATCGTGTTGTCTGCCAATGCGGGCGGCACGGAAGTGTTGGGCAAGAACACCAATGGGGATGTGG
TGTTTAAGGTTTTATTAACTGCCAGCGATGGGGATGTGGAAGTCTTTCAATACCGTGCGATCAAACACGA
GAATGCCAGCGACCACGACGAATCCGGCGCGGGAGGCATAATAGAGCGCATTCAAGCCGGCTCTTTGAAA
TTGGAAGTGACTTTAACCGACAAAGACGGCGACAGTGCGAAAGGCGAGCTGGATTTGGGTCAAATGATGC
GCTTTGAAGACGACGGCCCTGTGGTTGATATGGCGGTGAAGGCAGGGGCTGCCTTGACGCTTGATGAAAC
GAAAGGAGTGAAAGCCGGCGATGCGAATGCGAACGACGAAGCGGCTTCTGCCGATGCCAATGACATTGGT
TATGCGAAGCTTGTCGGCAGTGATTTGTTTACTTTAACGAAAGACGCAGGCTCTGACGGGGAGCAATCCA
CCCTCTTTAAGCTTTTGGTGAGTGCTCCGGCTTCTGGTTTGGTGGATACGGCAACCAACCAGGCCATCGT
GTTGTCTGCCAATGCGGGCGGTACGGAAGTGTTGGGCAAGAACACCAATGGGGATGTGGTGTTTAAGGTT
TTATTAACTGCCAGCNATGGGGATGTGGAAGTCTTTCAATACCGTGCGATCAAACACGAGAATGCCAGCG
ACCACGACGAATCCGGCGCGGGAGGCATAATAGAGCGCATTCAAGCCGGCTCTTTGAAATTGGAAGTGAC
NTTAACCGACAAAGACGGCGACAGTGCGAAAGNCGANCTGGATTTGGGTCAAATGATGCGCTTTGAAGAC
GACGGCCCTGTGGTTGATATGGCGGTGAAGGCAGGGGCTGCCTTGACGCTTGATGAAACGNAAGGNNTGA
AAGCCGGCGATGCGAATGNGAACGACGAAGCGGCNTCTGCNGATGCCAATGACATTGGTTATGCGAAGCT
TGTCGGCAGTGATTTGTTTACTTTAACGAAAGACGCAGGCTCTGACGGGGANCAATCCACCCTCTTTAAG
CTTTTGGTGNGTGCTCCGGCTTCTGGTTTGGTGGATACGGCAACCAANCAGGCCATCGTGTTGTCTGCCA
ATGCGGGCGGNACGGAAGTGTTGGGCAAGAACACCAATGGGGATGTGGTGTTTAAGGTTTTATTAACTGC
CAGCNATGGGGATGTGGAAGTCTTTCAATACCGTGCGATCAAACACGAGAATGCCAGCGACCACGACGAA
TCCGGCGCGGGAGGCATAATAGAGCGCATTCAAGCCGGCTCTTTGAAATTGGAAGTGACCTTAACCGACA
AAGACGGCGACAGTGCGAAAGACGACCTGGATTTGGGTCAAATGATGCGCTTTGAAGACGACGGCCCTGT
GGTTGATATGGCGGTGAAGGCAGGGGCTGCCTTGACGCTTGATGAAACGAAAGGAGTGAAAGCCGGCGAT
GCGAATGCGAACGACGAAGCGGCTTCTGCCGATGCCAATGACATTGGTTATGCGAAGCTTGTCGGCAGTG
ATTTGTTTACTTTAACGAAAGACGCAGGCTCTGACGGGGAGCAATCCACCCTCTTTAAGCTTTTGGTGAG
TGCTCCGGCTTCTGGTTTGGTGGATACGGCAACCAATCAGGCCATCGTGTTGTCTGCCAATGCGGGCGGC
ACGGAAGTGTTGGGCAAGAACACCAATGGGGATGTGGTGTTTAAGGTTTTATTAACTGCCAGCAATGGGG
ATGTGGAAGTCTTTCAATACCGTGCGATCAAACACGAGAATGCCAGCGACCACGACGAATCCGGCGCGGG
AGGCATAATAGAGCGCATTCAAGCCGGCTCTTTGAAATTGGAAGTGACCTTAACCGACAAAGACGGCGAC
AGTGCGAAAGACGACCTGGATTTGGGTCAAATGATGCGCTTTGAAGACGACGGCCCTGTGGTTGATATGG
CGGTGAAGGCAGGGGCTGCCTTGACGCTTGATGAAACGAAAGGAGTGAAAGCCGGCGATGCGAATGCGAA
CGACGAAGCGGCATCTGCTGATGCCAATGACATTGGTTATGCGAAGCTTGTCGGCAGTGATTTGTTTACT
TTAACGAAAGACGCAGGCTCTGACGGGGAGCAATCCACCCTCTTTAAGCTTTTGGTGAGTGCTCCGGCTT
CTGGTTTGGTGGATACGGCAACCAATCAGGCCATCGTGTTGTCTGCCAATGCGGGCGGCACGGAAGTGTT
GGGCAAGAACACCAATGGGGATGTGGTGTTTAAGGTTTTATTAACTGCCAGCAATGGGGATGTGGAAGTC
TTTCAATACCGTGCGATCAAACACGAGAATGCCAGCGACCACGACGAATCCGGCGCGGGAGGCATAATAG
AGCGCATTCAAGCCGGCTCTTTGAAATTGGAAGTGACCTTAACCGACAAAGACGGCGACAGTGCGAAAGA
CGACCTGGATTTGGGTCAAATGATGCGCTTTGAAGACGACGGCCCTGTGGTTGATATGGCGGTGAAGGCA
GGGGCTGCCTTGACGCTTGATGAAACGAAAGGAGTGAAAGCCGGCGATGCGAATGCGAACGACGAAGCGG
CATCTGCTGATGCCAATGACATTGGTTATGCGAAGCTTGTCGGCAGTGATTTGTTTACTTTAACGAAAGA
CGCAGGCTCTGACGGGGAGCAATCCACCCTCTTTAAGCTTTTGGTGAGTGCTCCGGCTTCTGGTTTGGTG
GATACGGCAACCAACCAGGCCATCGTGTTGTCTGCCAATGCGGGCGGTACGGAAGTGTTGGGCAAGAACA
CCAATGGGGATGTGGTGTTTAAGGTTTTATTAACTGCCAGCGATGGGGATGTGGAAGTCTTTCAATACCG
TGCGATCAAACACGAGAATGCCAGCGACCACGACGAATCCGGCGCGGGAGGCATAATAGAGCGCATTCAA
GCCGGCTCTTTGAAATTGGAAGTGACCTTAACCGACAAAGACGGCGACAGTGCGAAAGACGACCTGGATT
TGGGTCAAATGATGCGCTTTGAAGACGACGGCCCTGTGGTTGATATGGCGGTGAAGGCAGGGGCTGCCTT
GACGCTTGATGAAACGAAAGGAGTGAAAGCCGGCGATGCGAATGGGAACGACGAAGCGGCTTCTGCCGAT
GCCAATGACATTGGTTATGCGAAGCTTGTCGGCAGTGATTTGTTTACTTTAACGAAAGACGCAGGCTCTG
ACGGGGAGCAATCCACCCTCTTTAAGCTTTTGGTGAGTGCTCCGGCTTCTGGTTTGGTGGATACGGCAAC
CAACCAGGCCATCGTGTTGTCTGCCAATGCGGGCGGTACGGAAGTGTTGGGCAAGAACACCAATGGGGAT
GTGGTGTTTAAGGTTTTATTAACTGCCAGCGATGGGGATGTGGAAGTCTTTCAATACCGTGCGATCAAAC
ACGAGAATGCCAGCGACCACGACGAATCCGGCGCGGGAGGCATAATAGAGCGCATTCAAGCCGGCTCTTT
GAAATTGGAAGTGACCTTAACCGACAAAGACGGCGACAGTGCGAAAGACGACCTGGATTTGGGTCAAATG
ATGCGCTTTGAAGACGACGGCCCTGTGGTTGATATGGCGGTGAAGGCAGGGGCTGCCTTGACGCTTGATG
AAACGAAAGGAGTGAAAGCCGGCGATGCGAATGCGAACGACGAAGCGGCTTCTGCCGATGCCAATGACAT
TGGTTATGCGAAGCTTGTCGGCAGTGATTTGTTTACTTTAACGAAAGACGCAGGCTCTGACGGGGAGCAA
TCCACCCTCTTTAAGCTTTTGGTGAGTGCTCCGGCTTCTGGTTTGGTGGATACGGCAACCAATCAGGCCA
TCGTGTTGTCTGCCAATGCGGGCGGTACGGAAGTGTTGGGCAAGAACACCAATGGGGATGTGGTGTTTAA
GGTTTTATTAACTGCCAGCGATGGGGATGTGGAAGTCTTTCAATACCGTGCGATCAAACACGAGAATGCC
AGCGACCACGACGAATCCGGCGCGGGAGGCATAATAGAGCGCATTCAAGCCGGCTCTTTGAAATTGGAAG
TGACCTTAACCGACAAAGACGGCGACAGTGCGAAAGGCGAGCTGGATTTGGGTCAAATGATGCGCTTTGA
AGACGACGGCCCTGTGGTTGATATGGCGGTGAAGGCAGGGGCTGCCTTGACGCTTGATGAAACGAAAGGA
GTGAAAGCCGGCGATGCGAATGCGAACGACGAAGCGGCATCTGCTGATGCCAATGACATTGGTTATGCGA
AGCTTGTCGGCAGTGATTTGTTTACTTTAACGAAAGACGCAGGCTCTGACGGGGAGCAATCCACCCTCTT
TAAGCTTTTGGTGGGTGCTCCGGCTTCTGGTTTGGTGGATACGGCAACCAATCAGGCCATCGTGTTGTCT
GCCAATGCGGGCGGCACGGAAGTGTTGGGCAAGAACACCAATGGGGATGTGGTGTTTAAGGTTTTATTAA
CTGCCAGCGATGGGGATGTGGAAGTCTTTCAATACCGTGCGATCAAACACGAGAATGCCAGCGACCACGA
CGAATCCGGCGCGGGAGGCATAATAGAGCGCATTCAAGCCGGCTCTTTGAAATTGGAAGTGACTTTAACC
GACAAAGACGGCGACAGTGCGAAAGGCGAGCTGGATTTGGGTCAAATGATGCGCTTTGAAGACGACGGCC
CTGTGGTTGATATGGCGGTGAAGGCAGGGGCTGCCTTGACGCTTGATGAAACGAAAGGAGTGAAAGCCGG
CGATGCGAATGCGAACGACGAAGCGGCTTCTGCCGATGCCAATGACATTGGTTATGCGAAGCTTGTCGGC
AGTGATTTGTTTACTTTAACGAAAGACGCAGGCTCTGACGGGGAGCAATCCACCCTCTTTAAGCTTTTGG
TGGGTGCTCCGGCTTCTGGTTTGGTGGATACGGCAACCAACCAGGCCATCGTGTTGTCTGCCAATGCGGG
CGGTACGGAAGTGTTGGGCAAGAACACCAATGGGGATGTGGTGTTTAAGGTTTTATTAACTGCCAGCGAT
GGGGATGTGGAAGTCTTTCAATACCGTGCGATCAAACACGAGAATGCCAGCGACCACGACGAATCCGGCG
CGGGAGGCATAATAGAGCGCATTCAAGCCGGCTCTTTGAAATTGGAAGTGACCTTAACCGACAAAGACGG
CGACAGTGCGAAAGGCGAGCTGGATTTGGGTCAAATGATGCGCTTTGAAGACGACGGCCCTGTGGTTGAT
ATGGCGGTGAAGGCAGGGGCTGCCTTGACGCTTGATGAAACGAAAGGAGTGAAAGCCGGCGATGCGAATG
CGAACGACGAAGCGGCTTCTGCCGATGCCAATGACATTGGTTATGCGAAGCTTGTCGGCAGTGATTTGTT
TACTTTAACGAAAGACGCAGGCTCTGACGGGGAGCAATCCACCCTCTTTAAGCTTTTGGTGAGTGCTCCG
GCTTCTGGTTTGGTGGATACGGCAACCAATCAGGCCATCGTGTTGTCTGCCAATGCGGGCGGCACGGAAG
TGTTGGGCAAGAACACCAATGGGGATGTGGTGTTTAAGGTTTTATTAACTGCCAGCGATGGGGATGTGGA
AGTCTTTCAATACCGTGCGATCAAACACGAGAATGCCAGCGACCACGACGAATCCGGCGCGGGAGGCATA
ATAGAGCGCATTCAAGCCGGCTCTTTGAAATTGGAAGTGACCTTAACCGACAAAGACGGCGACAGTGCGA
AAGACGACCTGGATTTGGGTCAAATGATGCGCTTTGAAGACGACGGCCCTGTGGTTGATATGGCGGTGAA
GGCAGGGGCTGCCTTGACGCTTGATGAAACGAAAGGAGTGAAAGCCGGCGATGCGAATGCGAACGACGAA
GCGGCTTCTGCCGATGCCAATGACATTGGTTATGCGAAGCTTGTCGGCAGTGATTTGTTTACTTTAACGA
AAGACGCAGGCTCTGACGGGGAGCAATCCACCCTCTTTAAGCTTTTGGTGAGTGCTCCGGCTTCTGGTTT
GGTGGATACGGCAACCAATCAGGCCATCGTGTTGTCTGCCAATGCGGGCGGCACGGAAGTGTTGGGCAAG
AACACCAATGGGGATGTGGTGTTTAAGGTTTTATTAACTGCCAGCGATGGGGATGTGGAAGTCTTTCAAT
ACCGTGCGATCAAACACGAGAATGCCAGCGACCACGACGAATCCGGCGCGGGAGGCATAATAGAGCGCAT
TCAAGCCGGCTCTTTGAAATTGGAAGTGACCTTAACCGACAAAGACGGCGACAGTGCGAAAGACGACCTG
GATTTGGGTCAAATGATGCGCTTTGAAGACGACGGCCCTGTGGTTGATATGGCGGTGAAGGCAGGGGCTG
CCTTGACGCTTGATGAAACGAAAGGAGTGAAAGCCGGCGATGCGAATGCGAACGACGAAGCGGCATCTGC
TGATGCCAATGACATTGGTTATGCGAAGCTTGTCGGCAGTGATTTGTTTACTTTAACGAAAGACGCAGGC
TCTGACGGGGAGCAATCCACCCTCTTTAAGCTTTTGGTGAGTGCTCCGGCTTCTGGTTTGGTGGATACGG
CAACCAACCAGGCCATCGTGTTGTCTGCCAATGCGGGCGGTACGGAAGTGTTGGGCAAGAACACCAATGG
GGATGTGGTGTTTAAGGTTTTATTAACTGCCAGCAATGGGGATGTGGAAGTCTTTCAATACCGTGCGATC
AAACACGAGAATGCCAGCGACCACGACGAATCCGGCGCGGGAGGCATAATAGAGCGCATTCAAGCCGGCT
CTTTGAAATTGGAAGTGACTTTAACCGACAAAGACGGCGACAGTGCGAAAGGCGAGCTGGATTTGGGTCA
AATGATGCGCTTTGAAGACGACGGCCCTGTGGTTGATATGGCGGTGAAGGCAGGGGCTGCCTTGACGCTT
GATGAAACGCAAGGGATGAAAGCCGGCGATGCGAATGCGAACGACGAAGCGGCATCTGCTGATGCCAATG
ACATTGGTTATGCGAAGCTTGTCGGCAGTGATTTGTTTACTTTAACGAAAGACGCAGGCTCTGACGGGGA
GCAATCCACCCTCTTTAAGCTTTTGGTGAGTGCTCCGGCTTCTGGTTTGGTGGATACGGCAACCAATCAG
GCCATCGTGTTGTCTGCCAATGCGGGCGGCACGGAAGTGTTGGGCAAGAACACCAATGGGGATGTGGTGT
TTAAGGTTTTATTAACTGCCAGCAATGGGGATGTGGAAGTCTTTCAATACCGTGCGATCAAACACGAGAA
TGCCAGCGACCACGACGAATCCGGCGCGGGAGGCATAATAGAGCGCATTCAAGCCGGCTCTTTGAAATTG
GAAGTGACCTTAACCGACAAAGACGGCGACAGTGCGAAAGACGACCTGGATTTGGGTCAAATGATGCGCT
TTGAAGACGACGGCCCTGTGGTTGATATGGCGGTGAAGGCAGGGGCTGCCTTGACGCTTGATGAAACGCA
AGGGATGAAAGCCGGCGATGCGAATGCGAACGACGAAGCGGCATCTGCTGATGCCAATGACATTGGTTAT
GCGAAGCTTGTCGGCAGTGATTTGTTTACTTTAACGAAAGACGCAGGCTCTGACGGGGAGCAATCCACCC
TCTTTAAGCTTTTGGTGAGTGCTCCGGCTTCTGGTTTGGTGGATACGGCAACCAATCAGGCCATCGTGTT
GTCTGCCAATGCGGGCGGCACGGAAGTGTTGGGCAAGAACACCAATGGGGATGTGGTGTTTAAGGTTTTA
TTAACTGCCAGCAATGGGGATGTGGAAGTCTTTCAATACCGTGCGATCAAACACGAGAATGCCAGCGACC
ACGACGAATCCGGCGCGGGAGGCATAATAGAGCGCATTCAAGCCGGCTCTTTGAAATTGGAAGTGACTTT
AACCGACAAAGACGGCGACAGTGCGAAAGGCGAGCTGGATTTGGGTCAAATGATGCGCTTTGAAGACGAC
GGCCCTGTGGTTGATATGGCGGTGAAGGCAGGGGCTGCCTTGACGCTTGATGAAACGAAAGGAGTGAAAG
CCGGCGATGCGAATGCGAACGACGAAGCGGCATCTGCTGATGCCAATGACATTGGTTATGCGAAGCTTGT
CGGCAGTGATTTGTTTACTTTAACGAAAGACGCAGGCTCTGACGGGGAGCAATCCACCCTCTTTAAGCTT
TTGGTGAGTGCTCCGGCTTCTGGTTTGGTGGATACGGCAACCAACCAGGCCATCGTGTTGTCTGCCAATG
CGGGCGGCACGGAAGTGTTGGGCAAGAACACCAATGGGGATGTGGTGTTTAAGGTTTTATTAACTGCCAG
CAATGGGGATGTGGAAGTCTTTCAATACCGTGCGATCAAACACGAGAATGCCAGCGACCACGACGAATCC
GGCGCGGGAGGCATAATAGAGCGCATTCAAGCCGGCTCTTTGAAATTGGAAGTGACCTTAACCGACAAAG
ACGGCGACAGTGCGAAAGACGACCTGGATTTGGGTCAAATGATGCGCTTTGAAGACGACGGCCCTGTGGC
TGGTACCATAAGCCTGGTAGCTGATGAGGACAATTTGCCAAGAGGCAATAATGACACAGCTTCAGGAGAT
GCTGCTCAAAGCAATTTAACTGGTACATTGCCTGTTAATTTTGGTGCTGATGGTGCAGGTAGCATTGATT
TTCAAGGTATGCATGGTCTGAGTGCTGTCATAGGTAATGATAACATTACTTACAACTGGAATGCTTCTAC
GAATACGTTGACAGCCTATCAAACAGGAGGAGCCTTAGGGGTTAACGATGTGTTTAAAATAGTAGTTAAT
CCGACAACAGGTCAGTATACGTTTACTCTGCTGGCTGCTATTAATCATCATGCTGTTGCTGATAATACCG
AAGGATTGGTTGATCCATTTGTGAATCTTAATTATCGAGTTATTGATGGCGATGGGGATACTGCAATTGG
AACTCTAAAAGTAACAATTGATGACGATATACCTAAAGCAATTACACCTGAAGAAGGTTTTGTAACGAAT
CAAGCCGGTATTGTAAGAACATTTGATTTGGATTTTGATGCCAATATTGATAATAACGTCGGAGCAGATC
AATTAGGTACAATTACTTTTTCTGGTATCACCAATGGACAAGTTGTTACAGGGACAGTTGATGGTGTTCC
GAATCAGACTTTAACCTCAGGAGGATCAGCTATCCACTATTACGTGAGTGGTAATAATGTGGTTGAGGGC
TGGATTAATGGTGGGCCTGGGGATGTGGGTTCCACAATTGTGTTTAGGACTACTTTGCAACCTGATATGA
ACTATAACGCTAGTAATGACACCTATAAATTCGAATTGTTCCAACCAATTAGCACATCCACAAATGTGAG
TATTGCAAATTTTAGTGGTGTTAATGCGACTAGTAGAGAGTTCATATATCTTGAGAATGCCAGTGGTCCT
GGGGAAGACATATTATTTTCTGCTTACATAAGAAATGATAATGGCACTTTTACTGATGCTACTGTTAATA
CTAATCCTGATGGCATAGGTGTTAATAATCAGAACATGAATGATCGTGAGAATTTACGTGTTGATTTTGT
CAGGAACGCCTCTACAACTGGTACAAATCAAAATATGACTTATGAATACGATGATCATTATCTCGTTAAT
AACTTTAGTTTTAAAATTATTCAGGTTACAGGAAATCCTCCGACAGGATCACTAGAAGTATGGGTTCGTG
CTTATAATGCGGATGATGATGATCCGACTGATAATACAGCTAGTTCTGCAAATAATTTGGCCCATCAAGA
TGCATTAAGAGATGATCCGCAAGTAGCACTCACACAAATTTTAGTGAATGGTGTGCCAGTTACTCCAACC
ACGGTTAACGCTAGTGGTGGCTATTTAATTAGTGGCTTAAATTTAAATGATACGATAACAATTCGTTCTG
CGAATGGATATGACCGTGTAGAAATAGAAAACCCACGTTCAGGCGCTCATGGAGTTTCAAATTCCAGTTT
GAACAATGAAACATTTGATATTGGCTTATTCTCTTACAATACAATTAAAACTACTCCTTCTGAAATCAAT
ATTAACATGGGTCTTTCATTGACGGACTCAGATGGCGATAAAATAAATTCTTCAATAGAAATTAATCTGG
CTCCTTCAGTATTTAAGGTTGGAGAAAATGTCGATGATACTTCCAGCTCTAACGTGCCTCACCGTGTAGG
AGGTGATACCGGTGTTATCGATGGATCTGGTGGCGCAGATATTTTGGTTGGTGATGTTGGTGGTGTAGAG
GTTGTTGGTACAACTGCTCGACTTGCGTTTATACTCGATGAATCAGGTAGTATGAGTCAAAATTTTGGAG
GAACAACCCGTTTAGAAGTACTAAAACAAGCAATGACTGATATATTAACTGAGCTCAGTAATACGCCTAA
TGCTAGCATAACAGTTCATTTGGTTAAATTTGCATCAGTAGTTAATGGTACAGGCACTTTCGAAATCACT
GGCGGAGGATTGCAGCAAGCTTTAGACTTTATATCTGGATTACAGATCCAGCAAGGTTTATTAGCCGGAA
CAAACTACGAAGCAGCGTTGGGGCAAACCGTACAATGGTTTAGTAGTCAGTCTGGGACAGTGGATGTACA
GCAAACTCTATTTTTTACTGATGGAGTTCCTACTTTCTATATGGATGGGAATAGTACTGAATACACCAAT
CTTGCTCGTGTCTATGGAAATGGAAGCCAAACCGAGGAAGTTCTCTGGGAAAATCTATTCGGTGAGCACG
CTGGAGGTCAAGCAACATCGGATCGAATTAATAATCTCACAGAGTCTGATTCCAGAGATTTGGACGGTCT
TCAAAGCTATTCTATTGACACCAACAATGATGGTATTTTTGAAATTCAATCAGTGAATTCACGAAGTTCT
GGAACAACACAAACTACAAATGACTTGGTAAGAAGTGTTGCAGATACTTTCAATGAAGTACAAGCTTTGC
AGGCATATGGTCCTTTGCGAGCAGTTTCTATAGCGGATAATGCTAATGTTTATCTGCAAGAAATAGATAG
TACAGGTCAACCTTATTTAGCTGATTCCCCTGAAGTGCTACAGGATATACTGGATGAATTAAATCCATTT
AATGTTTTACTTGCAGCGGGTAGTGATACCATTCAGGCTAATCAGGAAGATGATTTAATTTTTGGTGATG
TGTTATTCACTGATAAACTGGCTGAAGATGAAGGTCTTGATTTACCTAAAGGCTCAGGATGGGCAGTATT
TGAAGAGTTGGAAGCTAATCATGGATGGAGCAGGCAAGATACTTTAGATTATATAAGAAATCATGCTGAT
GAACTTGGTAGAGAAACAGTTCTCTCTAGTGGTAGTAAACGTTCTGGAGGACATGACATCATTAGCGGAG
GTCAGGGAGACGACAGAATATACGGGCAGGAAGGTAATGATGTCATAGATGCCGGTTCTGGGGATGATGT
CATAGATGCCGGTTCTGGGGATGATGTCATTGTGGGTGGAACCGGTAATGACACGCTAACTGGCGGATCA
GGAGCTGATCAATTCGTGTTTTTCAGGGGACATGGAAGTAATAATGCAGGAACAGCTCCAACTGATATTA
TTACAGATTTTGAAGTGAATATCGATAAGATCGTAATTAATGCTAATAATATTATCGGCGTGTCAGTTTC
TAATCCTGTAAGTAATCCTGATTTGAGTAAGACATATACTATTACAGTAAATTATTCTGATGCACCTAGC
ATTGAACACTTTAAAGTGACATTATCCAATGGTGCTTTATTGAATGACTCTGGAAAGACTCATTTGAACG
GAGTGGTTATAAGCGGCGGCACGGCTACCATTGATGGCACAATCGTTGGTGCAGTTCTATATTTGGATCT
GAATGCTAATAATCAGGAGGATGAAGGGGAACGACTGGGTATCACCAATCAATATGGTCATGTGGAATGG
GTCGTTGATCTCTCTAAATTCGATGTCAACGGTGATGGTCAGTATGTTATAGGCGAGGCTCGTGCTGTTC
AAACCGGTGGTTTTGATATAGATACAGGTCTTAGCTATGAAATAAATCTTTACGGGCCAGTAGGTTCAGC
AGTTATATCGCCCTTGACAAGCCTCTTGCAAGCGCAGCTAGAAGCCGGCATGGATTATGAGACAGCTAAT
GCTGCCTTGGTTGCTCGCTTAGGGTTACCAGAGGGAACACAAATTATTAGTTTCAATCCGATTACTGGCA
GTGGTGAAGTGCTGGCTCAAAACGCAGGTGTAATGACAGCTGCCATTCAGTTTGCTGAAATAGCCGCAAT
ACACTATTCAACCGATGAAGGTCATGTTTCATTCGCTGTCTTTGAGGCAATTAGCAAGGCATTGCTTGAA
CTTCCTGAAGGGGTAGTCGCTGATTTTGGCGATGAGGGTTTCTTGCAGTCCATTGCAAATTATCTGGGAT
TAGATGCTCTGGTTACCTCTGATATGATTGACTATATGGCAACCAGCCAGAAAGCGTTAGAAGCCAGTAT
TTTGACTCTTGCGCCCGGAGAAGATGCTCTGACGGCCATCAGCAAGATACAGCATGTGACCCAAGGTATA
TATGCCCAAGCTATTGAAATGGCATTGATAGGGTATTTGCCATTAGATGCTCTTAAAAACATGAGTGCTG
TTCTTAAGGCTTATGCTGATGGAGATATTACGGATGAACAACTCAACTCCTTTGAAGACAAGCTTTCTGC
TGTGATTGTGAATTGGGAAGATAACAATGTTACAGACGCATCTCATCAGGCCACATTGCAAACAGAGCGT
ACTGTTGATGACTCTTCAGTCAAATCAGAGGCGAATCATGAAATGGCACAAGAAGTTAATGCCGTGATTA
ATGATTTTATGGATGAACATAATATTTCTTTGTACTATTATGATCAACAGGCTCAAATGCCTCAAGAAAC
ACAAGAAGAACAACAGCCAGTAGAAGCTCAGGCTGAAGAGACGGTCATACATGACGACGTTGTTCAAGAT
CTGTTGCTTGATGATCATAGCCTTACCATGTTAGCTAACAATCCCGAATTAAATGGTGGTAATGGCAATG
ATGTTCTACATGGAACTACCGGAAACGATTTTATAAGAGGCGGTCAAGGAAATGATACGATGACAGGTGG
TGGCGGTGTTGATACCTTCTTCTGGTTAAGTGGCGACGATGATGGTGGTGTGGATACTATTACCGATTTC
AAAGCAAATCCTGTTGATCAATCATCAGATGCCAGCGTCCTTAACTTAAGTGATTTGCTATCTGATGCGG
ATCTGGAAACCAATAGTTTGGATAATTATCTGAATGTTTCTACCACAGAAGAGGGTGACACAGCCATTAA
AGTAGATCCTAATGGCAATGGAAATTTTGACGCTCCAGCGCAAACGATTATATTAGAAGATGTTGATTTA
ACAGCCGTTTTCGCTACTAACAATTCGCATGATATTGTGAATCAAATGATCGCTAATGGAAACTTGATAG
TAGAACAGTAAGATGAACTCATTACATTGGTGAATATGGAATTCACCAAT

Protein Sequence
>gi|54296668|ref|YP_123037.1| structural toxin protein RtxA [Legionella pneumophila str. Paris]
MLAESVIGIVRAVNGLLEKVNAQGQASLVKSGARLQEGDVLTLLSGEAYIQFIHGFPEALALGKPVNLYG
VSPALQYGVEELNEQLVQEALAKGIDPSVILDVLGSAAAGAEAVGSGGDAFIMDPLFGFGHVTAGYPTGP
ISFAYEADTQQLFWFVPEETGVIAESELTQEPESIPQIPQFTTNQAVLTVFEDALPSGIADSAGQARIAS
SSLSSLLTSSADVAASFAFNSNLSALPTLKSGGIDLSYELSADKRTLTLRESNTQGPGAEVMKFELTADG
QLTQTLMNSIDHPTADSDDGEWMRLDLSPLIDVTFTRTIDGSVLESRTLPANAVVAGIQDDVPIARAQLT
NNEILLDETIGMKVGDVDAANDDFNPTTTADPFNNTYGIPIGLVQNANLLDTSTSEMGGDYKNATMTHLI
KITDAVSGLQTTDGTPVNLFLESNGDISGRAGDIGAPAVFAIRMNPNTGAITVAQYGSIKQFDTNSYDEA
VDLTGRISVVVTAKDSDGDVSNAEIPIGQLIIFEDDGPVVDMAVKAGAALTLDETKGVKAGDANANDEAA
SADANDIGYAKLVGSDLFTLTKDAGSDGXQSTLFKLLVXAPASGLVDTATXQAIVLSANAGGTEVLGKNT
NGDVVFKVLLTASXGDVEVFQYRAIKHENASDHDESGAGGIIERIQAGSLKLEVTLTDKDGDSAKXXLDL
GQMMRFEDDGPVVDMAVKAGAALTLDETKGVKAGDANANDEAASADANDIGYAKLVGSDLFTLTKDAGSD
GEQSTLFKLLVSAPASGLVDTATNQAIVLSANAGGTEVLGKNTNGDVVFKVLLTASNGDVEVFQYRAIKH
ENASDHDESGAGGIIERIQAGSLKLEVTLTDKDGDSAKDDLDLGQMMRFEDDGPVVDMAVKAGAALTLDE
TQGMKAGDANANDEAASADANDIGYAKLVGSDLFTLTKDAGSDGEQSTLFKLLVSAPASGLVDTATNQAI
VLSANAGGTEVLGKNTNGDVVFKVLLTASNGDVEVFQYRAIKHENASDHDESGAGGIIERIQAGSLKLEV
TLTDKDGDSAKDDLDLGQMMRFEDDGPVVDMAVKAGAALTLDETQGMKAGDANANDEAASADANDIGYAK
LVGSDLFTLTKDAGSDGEQSTLFKLLVGAPASGLVDTATNQAIVLSANAGGTEVLGKNTNGDVVFKVLLT
ASNGDVEVFQYRAIKHENASDHDESGAGGIIERIQAGSLKLEVTLTDKDGDSAKDDLDLGQMMRFEDDGP
VVDMAVKAGAALTLDETKGVKAGDANANDEAASADANDIGYAKLVGSDLFTLTKDAGSDGEQSTLFKLLV
SAPASGLVDTATNQAIVLSANAGGTEVLGKNTNGDVVFKVLLTASNGDVEVFQYRAIKHENASDHDESGA
GGIIERIQAGSLKLEVTLTDKDGDSAKGELDLGQMMRFEDDGPVVDMAVKAGAALTLDETKGVKAGDANA
NDEAASADANDIGYAKLVGSDLFTLTKDAGSDGEQSTLFKLLVSAPASGLVDTATNQAIVLSANAGGTEV
LGKNTNGDVVFKVLLTASNGDVEVFQYRAIKHENASDHDESGAGGIIERIQAGSLKLEVTLTDKDGDSAK
DDLDLGQMMRFEDDGPVVDMAVKAGAALTLDETKGVKAGDANANDEAASADANDIGYAKLVGSDLFTLTK
DAGSDGEQSTLFKLLVSAPASGLVDTATNQAIVLSANAGGTEVLGKNTNGDVVFKVLLTASNGDVEVFQY
RAIKHENASDHDESGAGGIIERIQAGSLKLEVTLTDKDGDSAKDDLDLGQMMRFEDDGPVVDMAVKAGAA
LTLDETKGVKAGDANANDEAASADANDIGYAKLVGSDLFTLTKDAGSDGEQSTLFKLLVSAPASGLVDTA
TNQAIVLSANAGGTEVLGKNTNGDVVFKVLLTASNGDVEVFQYRAIKHENASDHDESGAGGIIERIQAGS
LKLEVTLTDKDGDSAKGELDLGQMMRFEDDGPVVDMAVKAGAALTLDETKGVKAGDANANDEAASADAND
IGYAKLVGSDLFTLTKDAGSDGXQSTLFKLLVXAPASGLVDTATXQAIVLSANAGGTEVLGKNTNGDVVF
KVLLTASXGDVEVFQYRAIKHENASDHDESGAGGIIERIQAGSLKLEVTLTDKDGDSAKXXLDLGQMMRF
EDDGPVVDMAVKAGAALTLDETXGXKAGDANXNDEAASADANDIGYAKLVGSDLFTLTKDAGSDGXQSTL
FKLLVXAPASGLVDTATXQAIVLSANAGGTEVLGKNTNGDVVFKVLLTASXGDVEVFQYRAIKHENASDH
DESGAGGIIERIQAGSLKLEVTLTDKDGDSAKXXLDLGQMMRFEDDGPVVDMAVKAGAALTLDETXGXKA
GDANXNDEAASADANDIGYAKLVGSDLFTLTKDAGSDGXQSTLFKLLVXAPASGLVDTATXQAIVLSANA
GGTEVLGKNTNGDVVFKVLLTASXGDVEVFQYRAIKHENASDHDESGAGGIIERIQAGSLKLEVTLTDKD
GDSAKXXLDLGQMMRFEDDGPVVDMAVKAGAALTLDETXGXKAGDANXNDEAASADANDIGYAKLVGSDL
FTLTKDAGSDGXQSTLFKLLVXAPASGLVDTATXQAIVLSANAGGTEVLGKNTNGDVVFKVLLTASXGDV
EVFQYRAIKHENASDHDESGAGGIIERIQAGSLKLEVTLTDKDGDSAKXXLDLGQMMRFEDDGPVVDMAV
KAGAALTLDETXGXKAGDANXNDEAASADANDIGYAKLVGSDLFTLTKDAGSDGXQSTLFKLLVXAPASG
LVDTATXQAIVLSANAGGTEVLGKNTNGDVVFKVLLTASXGDVEVFQYRAIKHENASDHDESGAGGIIER
IQAGSLKLEVTLTDKDGDSAKXXLDLGQMMRFEDDGPVVDMAVKAGAALTLDETXGXKAGDANXNDEAAS
ADANDIGYAKLVGSDLFTLTKDAGSDGXQSTLFKLLVXAPASGLVDTATXQAIVLSANAGGTEVLGKNTN
GDVVFKVLLTASXGDVEVFQYRAIKHENASDHDESGAGGIIERIQAGSLKLEVTLTDKDGDSAKXXLDLG
QMMRFEDDGPVVDMAVKAGAALTLDETXGXKAGDANXNDEAASADANDIGYAKLVGSDLFTLTKDAGSDG
EQSTLFKLLVGAPASGLVDTATNQAIVLSANAGGTEVLGKNTNGDVVFKVLLTASDGDVEVFQYRAIKHE
NASDHDESGAGGIIERIQAGSLKLEVTLTDKDGDSAKGELDLGQMMRFEDDGPVVDMAVKAGAALTLDET
KGVKAGDANANDEAASADANDIGYAKLVGSDLFTLTKDAGSDGEQSTLFKLLVSAPASGLVDTATNQAIV
LSANAGGTEVLGKNTNGDVVFKVLLTASXGDVEVFQYRAIKHENASDHDESGAGGIIERIQAGSLKLEVT
LTDKDGDSAKXXLDLGQMMRFEDDGPVVDMAVKAGAALTLDETXGXKAGDANXNDEAASADANDIGYAKL
VGSDLFTLTKDAGSDGXQSTLFKLLVXAPASGLVDTATXQAIVLSANAGGTEVLGKNTNGDVVFKVLLTA
SXGDVEVFQYRAIKHENASDHDESGAGGIIERIQAGSLKLEVTLTDKDGDSAKDDLDLGQMMRFEDDGPV
VDMAVKAGAALTLDETKGVKAGDANANDEAASADANDIGYAKLVGSDLFTLTKDAGSDGEQSTLFKLLVS
APASGLVDTATNQAIVLSANAGGTEVLGKNTNGDVVFKVLLTASNGDVEVFQYRAIKHENASDHDESGAG
GIIERIQAGSLKLEVTLTDKDGDSAKDDLDLGQMMRFEDDGPVVDMAVKAGAALTLDETKGVKAGDANAN
DEAASADANDIGYAKLVGSDLFTLTKDAGSDGEQSTLFKLLVSAPASGLVDTATNQAIVLSANAGGTEVL
GKNTNGDVVFKVLLTASNGDVEVFQYRAIKHENASDHDESGAGGIIERIQAGSLKLEVTLTDKDGDSAKD
DLDLGQMMRFEDDGPVVDMAVKAGAALTLDETKGVKAGDANANDEAASADANDIGYAKLVGSDLFTLTKD
AGSDGEQSTLFKLLVSAPASGLVDTATNQAIVLSANAGGTEVLGKNTNGDVVFKVLLTASDGDVEVFQYR
AIKHENASDHDESGAGGIIERIQAGSLKLEVTLTDKDGDSAKDDLDLGQMMRFEDDGPVVDMAVKAGAAL
TLDETKGVKAGDANGNDEAASADANDIGYAKLVGSDLFTLTKDAGSDGEQSTLFKLLVSAPASGLVDTAT
NQAIVLSANAGGTEVLGKNTNGDVVFKVLLTASDGDVEVFQYRAIKHENASDHDESGAGGIIERIQAGSL
KLEVTLTDKDGDSAKDDLDLGQMMRFEDDGPVVDMAVKAGAALTLDETKGVKAGDANANDEAASADANDI
GYAKLVGSDLFTLTKDAGSDGEQSTLFKLLVSAPASGLVDTATNQAIVLSANAGGTEVLGKNTNGDVVFK
VLLTASDGDVEVFQYRAIKHENASDHDESGAGGIIERIQAGSLKLEVTLTDKDGDSAKGELDLGQMMRFE
DDGPVVDMAVKAGAALTLDETKGVKAGDANANDEAASADANDIGYAKLVGSDLFTLTKDAGSDGEQSTLF
KLLVGAPASGLVDTATNQAIVLSANAGGTEVLGKNTNGDVVFKVLLTASDGDVEVFQYRAIKHENASDHD
ESGAGGIIERIQAGSLKLEVTLTDKDGDSAKGELDLGQMMRFEDDGPVVDMAVKAGAALTLDETKGVKAG
DANANDEAASADANDIGYAKLVGSDLFTLTKDAGSDGEQSTLFKLLVGAPASGLVDTATNQAIVLSANAG
GTEVLGKNTNGDVVFKVLLTASDGDVEVFQYRAIKHENASDHDESGAGGIIERIQAGSLKLEVTLTDKDG
DSAKGELDLGQMMRFEDDGPVVDMAVKAGAALTLDETKGVKAGDANANDEAASADANDIGYAKLVGSDLF
TLTKDAGSDGEQSTLFKLLVSAPASGLVDTATNQAIVLSANAGGTEVLGKNTNGDVVFKVLLTASDGDVE
VFQYRAIKHENASDHDESGAGGIIERIQAGSLKLEVTLTDKDGDSAKDDLDLGQMMRFEDDGPVVDMAVK
AGAALTLDETKGVKAGDANANDEAASADANDIGYAKLVGSDLFTLTKDAGSDGEQSTLFKLLVSAPASGL
VDTATNQAIVLSANAGGTEVLGKNTNGDVVFKVLLTASDGDVEVFQYRAIKHENASDHDESGAGGIIERI
QAGSLKLEVTLTDKDGDSAKDDLDLGQMMRFEDDGPVVDMAVKAGAALTLDETKGVKAGDANANDEAASA
DANDIGYAKLVGSDLFTLTKDAGSDGEQSTLFKLLVSAPASGLVDTATNQAIVLSANAGGTEVLGKNTNG
DVVFKVLLTASNGDVEVFQYRAIKHENASDHDESGAGGIIERIQAGSLKLEVTLTDKDGDSAKGELDLGQ
MMRFEDDGPVVDMAVKAGAALTLDETQGMKAGDANANDEAASADANDIGYAKLVGSDLFTLTKDAGSDGE
QSTLFKLLVSAPASGLVDTATNQAIVLSANAGGTEVLGKNTNGDVVFKVLLTASNGDVEVFQYRAIKHEN
ASDHDESGAGGIIERIQAGSLKLEVTLTDKDGDSAKDDLDLGQMMRFEDDGPVVDMAVKAGAALTLDETQ
GMKAGDANANDEAASADANDIGYAKLVGSDLFTLTKDAGSDGEQSTLFKLLVSAPASGLVDTATNQAIVL
SANAGGTEVLGKNTNGDVVFKVLLTASNGDVEVFQYRAIKHENASDHDESGAGGIIERIQAGSLKLEVTL
TDKDGDSAKGELDLGQMMRFEDDGPVVDMAVKAGAALTLDETKGVKAGDANANDEAASADANDIGYAKLV
GSDLFTLTKDAGSDGEQSTLFKLLVSAPASGLVDTATNQAIVLSANAGGTEVLGKNTNGDVVFKVLLTAS
NGDVEVFQYRAIKHENASDHDESGAGGIIERIQAGSLKLEVTLTDKDGDSAKDDLDLGQMMRFEDDGPVA
GTISLVADEDNLPRGNNDTASGDAAQSNLTGTLPVNFGADGAGSIDFQGMHGLSAVIGNDNITYNWNAST
NTLTAYQTGGALGVNDVFKIVVNPTTGQYTFTLLAAINHHAVADNTEGLVDPFVNLNYRVIDGDGDTAIG
TLKVTIDDDIPKAITPEEGFVTNQAGIVRTFDLDFDANIDNNVGADQLGTITFSGITNGQVVTGTVDGVP
NQTLTSGGSAIHYYVSGNNVVEGWINGGPGDVGSTIVFRTTLQPDMNYNASNDTYKFELFQPISTSTNVS
IANFSGVNATSREFIYLENASGPGEDILFSAYIRNDNGTFTDATVNTNPDGIGVNNQNMNDRENLRVDFV
RNASTTGTNQNMTYEYDDHYLVNNFSFKIIQVTGNPPTGSLEVWVRAYNADDDDPTDNTASSANNLAHQD
ALRDDPQVALTQILVNGVPVTPTTVNASGGYLISGLNLNDTITIRSANGYDRVEIENPRSGAHGVSNSSL
NNETFDIGLFSYNTIKTTPSEININMGLSLTDSDGDKINSSIEINLAPSVFKVGENVDDTSSSNVPHRVG
GDTGVIDGSGGADILVGDVGGVEVVGTTARLAFILDESGSMSQNFGGTTRLEVLKQAMTDILTELSNTPN
ASITVHLVKFASVVNGTGTFEITGGGLQQALDFISGLQIQQGLLAGTNYEAALGQTVQWFSSQSGTVDVQ
QTLFFTDGVPTFYMDGNSTEYTNLARVYGNGSQTEEVLWENLFGEHAGGQATSDRINNLTESDSRDLDGL
QSYSIDTNNDGIFEIQSVNSRSSGTTQTTNDLVRSVADTFNEVQALQAYGPLRAVSIADNANVYLQEIDS
TGQPYLADSPEVLQDILDELNPFNVLLAAGSDTIQANQEDDLIFGDVLFTDKLAEDEGLDLPKGSGWAVF
EELEANHGWSRQDTLDYIRNHADELGRETVLSSGSKRSGGHDIISGGQGDDRIYGQEGNDVIDAGSGDDV
IDAGSGDDVIVGGTGNDTLTGGSGADQFVFFRGHGSNNAGTAPTDIITDFEVNIDKIVINANNIIGVSVS
NPVSNPDLSKTYTITVNYSDAPSIEHFKVTLSNGALLNDSGKTHLNGVVISGGTATIDGTIVGAVLYLDL
NANNQEDEGERLGITNQYGHVEWVVDLSKFDVNGDGQYVIGEARAVQTGGFDIDTGLSYEINLYGPVGSA
VISPLTSLLQAQLEAGMDYETANAALVARLGLPEGTQIISFNPITGSGEVLAQNAGVMTAAIQFAEIAAI
HYSTDEGHVSFAVFEAISKALLELPEGVVADFGDEGFLQSIANYLGLDALVTSDMIDYMATSQKALEASI
LTLAPGEDALTAISKIQHVTQGIYAQAIEMALIGYLPLDALKNMSAVLKAYADGDITDEQLNSFEDKLSA
VIVNWEDNNVTDASHQATLQTERTVDDSSVKSEANHEMAQEVNAVINDFMDEHNISLYYYDQQAQMPQET
QEEQQPVEAQAEETVIHDDVVQDLLLDDHSLTMLANNPELNGGNGNDVLHGTTGNDFIRGGQGNDTMTGG
GGVDTFFWLSGDDDGGVDTITDFKANPVDQSSDASVLNLSDLLSDADLETNSLDNYLNVSTTEEGDTAIK
VDPNGNGNFDAPAQTIILEDVDLTAVFATNNSHDIVNQMIANGNLIVEQ

Molecule Role Virulence factor
Molecule Role Annotation MUTATION: rtxA mutant is attenuated in mice and doesn't grow as well in monocytes as the wild type (Cirillo et al., 2001).
COG COG2931Q, under Q: Secondary metabolites biosynthesis, transport and catabolism
References
Cirillo et al., 2001: Cirillo SL, Bermudez LE, El-Etr SH, Duhamel GE, Cirillo JD. Legionella pneumophila entry gene rtxA is involved in virulence. Infection and immunity. 2001; 69(1); 508-517. [PubMed: 11119544].