Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

dotB from Legionella pneumophila str. Paris

Victor ID 1475
Gene Name dotB from Legionella pneumophila str. Paris
Sequence Strain (Species/Organism) Legionella pneumophila str. Paris
NCBI Gene ID 3117986
NCBI Protein GI 54298666
Locus Tag lpp2730
Protein Accession YP_125035.1
Other Database IDs UniProtKB-ID: Q5X1L3_LEGPA
UniRef100: UniRef100_Q5X1L3
UniRef90: UniRef90_Q5ZS43
UniRef50: UniRef50_Q5ZS43
UniParc: UPI0000445256
EMBL: CR628336
EMBL-CDS: CAH13883.1
RefSeq_NT: NC_006368.1
GenomeReviews: CR628336_GR
KEGG: lpp:lpp2730
LegioList: lpp2730
eggNOG: COG2805
HOGENOM: HBG757455
OMA: IISERVY
ProtClustDB: CLSK914927
BioCyc: LPNE297246:LPP2730-MONOMER
Taxonomy ID 297246
Gene Starting Position 3109782
Gene Ending Position 3110915
Gene Strand (Orientation) +
Protein Name defect in organelle trafficking protein DotB (ATPase)
DNA Sequence
>gi|54295983:3109782-3110915 Legionella pneumophila str. Paris, complete genome
AATGTCTATGGATAATATTAATTTAATGCCCGATGAGCCAACTCGTTTCACTCCAGTATTCATGGACAGA
ATGCTGGAGCATGCAGAAAGCCTGAATGCTTCAGATATAACAATCCAAACTGGCGAACCCATTTTTGCAG
AGGTTTATGGAAGACTCCTTAAAATTACAAATCGACGTCTTTCCAATACAGAATTAGGCGACCTTATTAA
TTCCATTTATGGCCCGAATGCCACGACACAATTACTTTCCGGTAAAGATATAGATACTCATTATGAGTTT
CGACCCAACCGTGGTGTACGCTATCGATATAGGGTTAACGCGACTGCCTGCCTGGTTGAAGGTCATGATG
CCATTCAGATCACATTAAGAACTATTCCAACCACACCACCCAAACTCAGTACCATGAGCCTCCCTGATAA
CATTATTGAAGCGATTGCTCCACAGGAAGGAATTGTGTTTATCACAGGCGCTACCGGTTCGGGCAAATCG
ACATTGTTGGCCTCCATTATTCGAGAGCTTATTGAAACATCAGACTCAAACCGCAAAGTATTAACTTACG
AATCCCCGATAGAATTCGTCTATGATGAAATTGAAACAATTTCCGCTGTAGTAAGCCAATCAGAGATTCC
AAGGCACTTACCCAACTTTGCTGATGGAGTAAGAAACGCATTAAGACGAAAGCCGAGATTAATTATGGTG
GGTGAATGTCGTGATGCAGAAACCATCAGCGCCGCTCTTGAAGCCGCTTTAACAGGGCACCCTGTCTACA
CAACCCTGCATACTTCTGGTGTTGCAGAAACGATGCGACGTCTGGTCACATCTTTTAGCGGGGAAGAGCG
TTTGGGAAGAACCATCGATATTCTTGAAACAATTAGGCTTTGCATTTGGCAAAAACTCGTCCCAACCGTT
GATGAAAGACGTGTAGCCTTAAGGGAATATCTGGTATTTGATGAGGAAGTGAGGGATATTCTATTGGAGG
GAGACCCTAACGAAGTGACTTCAGCCACACGTAAGTTAGTGAGGCAAAAAGGGCAATTAATGACTTGGGA
CGCAAAAATGAAATTTGAACAGGGGATTATCAGTGAGCGAGTTTATAAATTAATCATTGCTGGGGCCAAA
GAATATCAACAATA
Protein Sequence
>gi|54298666|ref|YP_125035.1| defect in organelle trafficking protein DotB (ATPase) [Legionella pneumophila str. Paris] MSMDNINLMPDEPTRFTPVFMDRMLEHAESLNASDITIQTGEPIFAEVYGRLLKITNRRLSNTELGDLINSIYGPNATTQLLSGKDIDTHYEFRPNRGVRYRYRVNATACLVEGHDAIQITLRTIPTTPPKLSTMSLPDNIIEAIAPQEGIVFITGATGSGKSTLLASIIRELIETSDSNRKVLTYESPIEFVYDEIETISAVVSQSEIPRHLPNFADGVRNALRRKPRLIMVGECRDAETISAALEAALTGHPVYTTLHTSGVAETMRRLVTSFSGEERLGRTIDILETIRLCIWQKLVPTVDERRVALREYLVFDEEVRDILLEGDPNEVTSATRKLVRQKGQLMTWDAKMKFEQGIISERVYKLIIAGAKEYQQ
Molecule Role Virulence factor
Molecule Role Annotation MUTATION: dotB mutant is attenuated in guinea pigs (Edelstein et al., 1999).
COG COG2805NU, under N: Cell motility; U: Intracellular trafficking, secretion, and vesicular transport
References
Edelstein et al., 1999: Edelstein PH, Edelstein MA, Higa F, Falkow S. Discovery of virulence genes of Legionella pneumophila by using signature tagged mutagenesis in a guinea pig pneumonia model. Proceedings of the National Academy of Sciences of the United States of America. 1999; 96(14); 8190-8195. [PubMed: 10393970].