Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

icmX from Legionella pneumophila str. Paris

Victor ID 1476
Gene Name icmX from Legionella pneumophila str. Paris
Sequence Strain (Species/Organism) Legionella pneumophila str. Paris
NCBI Gene ID 3118177
NCBI Protein GI 54298679
Locus Tag lpp2743
Protein Accession YP_125048.1
Other Database IDs UniProtKB-ID: Q5X1K0_LEGPA
UniRef100: UniRef100_Q5X1K0
UniRef90: UniRef90_Q5X1K0
UniRef50: UniRef50_Q5X1K0
UniParc: UPI0000445262
EMBL: CR628336
EMBL-CDS: CAH13896.1
RefSeq_NT: NC_006368.1
GenomeReviews: CR628336_GR
KEGG: lpp:lpp2743
LegioList: lpp2743
HOGENOM: HBG520266
OMA: QINDASP
ProtClustDB: CLSK833558
BioCyc: LPNE297246:LPP2743-MONOMER
Taxonomy ID 297246
Gene Starting Position 3125732
Gene Ending Position 3127150
Gene Strand (Orientation) +
Protein Name Intracellular multiplication protein IcmX
DNA Sequence
>gi|54295983:3125732-3127150 Legionella pneumophila str. Paris, complete genome
AATGAAAGTATTACCTAAACTGGCCTTGGCCAATCTGTTTTGTTTTACCACTTTATCTGTATCTGTTTGC
GCTCAATCGGGTATTGATACGTCAGGACAACAAACAAGCACCAACACGTCCAATCTGGTGACTTACCTCA
CCAATCTGGGAAAATATTTAGGCTATGACATCACTCAATCTAATAAAACGCCTAACCCGCCTTATTCACA
ATTATTTAATTCCAATGTAGCCCAACTCATTCAAAATTACGCTTACAATACCTTTTTGGGCGCTATCCCC
GTGAATGCCATGTCCCAGAGTTTTATGAATTTTGTGACCCAAAATGTGCAAGGAAGCTCATTAATTAATA
ATTTGGCGAATAATACCTTTAAATATCAAAATTTCAGCACCCCATCATCCGGCCTGAATGGAACAGTTTC
TGCCAACAGTTTAATAGACCAATCAACGGCCAATGCCCAAGCCCCTACCCCCTCAGGAGTTTTTTCAGAC
CCACAAACTACACCCTCCGGAACTTATTTGAAGGATCCAGTCAGTCAGGCCGTATTCAATATTCTGGGAA
CCCCAGATTACAGTTTTTGTATGGACAACGAGCAAAAAAACTGGTTGCCAAATTGCAACCTGATGTACCA
AAACCTGGTCATGCAAAATGTTATCGGCACTTTGCCCCCAGCGCAAACCTCTGGTTCGACACCTGCTTTT
TATACCTACAATTATAACCAATCGCTCATTGGCCAACTGAACGGCAACTCGCTGATTGCCCCGTTGCTAT
TAGATACCAATCCAGCACCACTACAGCAATTGAGTAGCTCTGGAGGCTTAAAAGCTATCAGCCAAGCACA
GCAAGCGCTTAATTTTATTAGATACGCAAGTGCTCAAGTCACTCCTCCTTCATTACCCAAGTTGAGTGCC
TACAGTGAATTATGGAATCAAGCCACTGCCAAACCGAATTCTGACGGTTATAATGAAGTCCAGCAAAAGC
AAGCAGCAGCAACATTGAGCGGTTATTTTAATAATTTGCGCGTTTACGCAGCACAAACTTCTGTCGGAGT
GAGTAATCTCTACTATATTTTATCCAAAAGGTTACCCCAAAATATGAGTGGCGACCAAAGCAACCAAAAT
CTGACAAGCCAGGCGTTGAATGAATTTAACATGGCAACTCGAAGATTATTTGATCCAACCGCCTCCAACA
CTCCCGGACAACCAAACCAACAATGGATTAAACAAATTAATGACGCCTCCCCTGCTACAGTTCAAAAAGA
AATAGCAGTATTGTTGGCTGAAATTAATTATCAAATGTATTTGGACAGACAAATACAAGAACGGATATTA
TTAACTAACAGCATTATGCTATTGCAAAACTTAAAAGCAGCGCAACCGACCGCAGACTTTTCAAGTCAAG
GCTCTCCTTCCGAGCAATA
Protein Sequence
>gi|54298679|ref|YP_125048.1| intracellular multiplication protein IcmX [Legionella pneumophila str. Paris] MKVLPKLALANLFCFTTLSVSVCAQSGIDTSGQQTSTNTSNLVTYLTNLGKYLGYDITQSNKTPNPPYSQLFNSNVAQLIQNYAYNTFLGAIPVNAMSQSFMNFVTQNVQGSSLINNLANNTFKYQNFSTPSSGLNGTVSANSLIDQSTANAQAPTPSGVFSDPQTTPSGTYLKDPVSQAVFNILGTPDYSFCMDNEQKNWLPNCNLMYQNLVMQNVIGTLPPAQTSGSTPAFYTYNYNQSLIGQLNGNSLIAPLLLDTNPAPLQQLSSSGGLKAISQAQQALNFIRYASAQVTPPSLPKLSAYSELWNQATAKPNSDGYNEVQQKQAAATLSGYFNNLRVYAAQTSVGVSNLYYILSKRLPQNMSGDQSNQNLTSQALNEFNMATRRLFDPTASNTPGQPNQQWIKQINDASPATVQKEIAVLLAEINYQMYLDRQIQERILLTNSIMLLQNLKAAQPTADFSSQGSPSEQ
Molecule Role Virulence factor
Molecule Role Annotation MUTATION: icmX mutant is attenuated in guinea pigs (Edelstein et al., 1999).
References
Edelstein et al., 1999: Edelstein PH, Edelstein MA, Higa F, Falkow S. Discovery of virulence genes of Legionella pneumophila by using signature tagged mutagenesis in a guinea pig pneumonia model. Proceedings of the National Academy of Sciences of the United States of America. 1999; 96(14); 8190-8195. [PubMed: 10393970].