Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

cpxR from Legionella pneumophila str. Paris

Victor ID 1477
Gene Name cpxR from Legionella pneumophila str. Paris
Sequence Strain (Species/Organism) Legionella pneumophila str. Paris
NCBI Gene ID 3118718
NCBI Protein GI 54297348
Locus Tag lpp1393
Protein Accession YP_123717.1
Other Database IDs UniProtKB-ID: Q5X5C7_LEGPA
UniRef100: UniRef100_A5IBT0
UniRef90: UniRef90_D3HTB6
UniRef50: UniRef50_A9FFH2
UniParc: UPI0000444D90
EMBL: CR628336
EMBL-CDS: CAH12544.1
RefSeq_NT: NC_006368.1
GenomeReviews: CR628336_GR
KEGG: lpp:lpp1393
LegioList: lpp1393
eggNOG: COG0745
HOGENOM: HBG753323
OMA: THSQANE
ProtClustDB: CLSK832796
BioCyc: LPNE297246:LPP1393-MONOMER
Taxonomy ID 297246
Gene Starting Position 1550951
Gene Ending Position 1551631
Gene Strand (Orientation) -
Protein Name transcriptional regulatory protein CpxR
DNA Sequence
>gi|54295983:1550951-1551631 Legionella pneumophila str. Paris, complete genome
GCTACGCATTAAACATGTACCCAAACCCGCGGACAGTTTTGACTAAAGGTTCCCCCTGGGGATTATCGCC
TAATTTATTTCGCAAATTGCTGATGTGAACATCGATACTGCGGTCATAAGCAGTGTATTTTCTTCCCAGA
GCATATTCGGTGAGTTCCTCTTTGGAAAATGCTTGTCCTGGTGATTTGATTAACATCTCCAAAATATTAA
ATTCCGCATTGGTTAATTCAAGGAATTTTCCTCCCATAGTCACGTGGCGTTTGGAGCAATCCACAATGAT
ATTATGTTGTTCAATAATTGGTTTGGGAGTTGGGATTTTTTGAGTGCGTCTTAAAATAGCACGCAGACGT
GCAACTAACTCTCTTGGATTACAGGGTTTAGGTAAGTAATCATCTGCACCAATTTCTAACCCAACAATGC
GATCGATATCATCACCACGAGCAGTTAACATCAATACAGGTGTTTCCAAATGCTCTCTTATTGCTTTTAA
TACTTCAAAACCATTAAGCTTAGGCAGCATGACGTCGAGTATAATGGCATCAAATACCTGATTTAAAGCT
TTTTTAACGCCATTTTCTCCATCATGAACGCATACTACATTAAAGCCTTCTGGCTCTAAATATTGAGTTA
ATAAATCTGTTAGTTCTGTGTCATCATCAATAATGAGAATAGAGCTGCTCA
Protein Sequence
>gi|54297348|ref|YP_123717.1| transcriptional regulatory protein CpxR [Legionella pneumophila str. Paris] MSSSILIIDDDTELTDLLTQYLEPEGFNVVCVHDGENGVKKALNQVFDAIILDVMLPKLNGFEVLKAIREHLETPVLMLTARGDDIDRIVGLEIGADDYLPKPCNPRELVARLRAILRRTQKIPTPKPIIEQHNIIVDCSKRHVTMGGKFLELTNAEFNILEMLIKSPGQAFSKEELTEYALGRKYTAYDRSIDVHISNLRNKLGDNPQGEPLVKTVRGFGYMFNA
Molecule Role Virulence factor
Molecule Role Annotation MUTATION: cpxR mutant is attenuated in mouse macrophages (Vincent et al., 2006).
COG COG0745TK, under T: Signal transduction mechanisms; K: Transcription
References
Vincent et al., 2006: Vincent CD, Buscher BA, Friedman JR, Williams LA, Bardill P, Vogel JP. Identification of non-dot/icm suppressors of the Legionella pneumophila DeltadotL lethality phenotype. Journal of bacteriology. 2006; 188(23); 8231-8243. [PubMed: 16997951].