Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

fur from Legionella pneumophila str. Paris

Victor ID 1479
Gene Name fur from Legionella pneumophila str. Paris
Sequence Strain (Species/Organism) Legionella pneumophila str. Paris
NCBI Gene ID 3119216
NCBI Protein GI 54296409
Locus Tag lpp0438
Protein Accession YP_122778.1
Other Database IDs UniProtKB-ID: Q5X815_LEGPA
UniRef100: UniRef100_Q48835
UniRef90: UniRef90_Q48835
UniRef50: UniRef50_Q48835
UniParc: UPI000012AD80
EMBL: CR628336
EMBL-CDS: CAH11586.1
RefSeq_NT: NC_006368.1
GenomeReviews: CR628336_GR
KEGG: lpp:lpp0438
LegioList: lpp0438
eggNOG: COG0735
HOGENOM: HBG731501
OMA: YGVCTND
ProtClustDB: CLSK914682
BioCyc: LPNE297246:LPP0438-MONOMER
Taxonomy ID 297246
Gene Starting Position 484343
Gene Ending Position 484763
Gene Strand (Orientation) +
Protein Name Ferric uptake regulation protein
DNA Sequence
>gi|54295983:484343-484763 Legionella pneumophila str. Paris, complete genome
AAGGAGCACAAGTGGAAGAGAGTCAACAGTTAAAAGACGCTGGATTAAAAATCACATTACCTCGTATCAA
GGTATTGCAAATATTGGAGCAATCAAGAAACCATCATTTGAGTGCAGAAGCAGTCTATAAAGCCTTATTG
GAATCGGGTGAGGATGTTGGGTTAGCTACTGTATATAGAGTTCTTACTCAATTTGAAGCAGCGGGATTAG
TATCGAGGCATAATTTTGAAGGAGGACACTCGGTGTTTGAGTTGTCTCAGGGCGAACATCATGACCATCT
TGTTTGTGTTAAGTGTGGGCGGGTAGAGGAATTTGTAGATGAAATAATAGAACAAAGACAAAAAGCAATT
GCCGAGCGCGCTCATTTTAAAATGACAGATCATGCGCTAAACATATATGGTATTTGTCCGCAGTGTCAAT
G
Protein Sequence
>gi|54296409|ref|YP_122778.1| ferric uptake regulation protein [Legionella pneumophila str. Paris] MEESQQLKDAGLKITLPRIKVLQILEQSRNHHLSAEAVYKALLESGEDVGLATVYRVLTQFEAAGLVSRHNFEGGHSVFELSQGEHHDHLVCVKCGRVEEFVDEIIEQRQKAIAERAHFKMTDHALNIYGICPQCQ
Molecule Role Virulence factor
Molecule Role Annotation MUTATION: fur mutant is attenuated in growth within U937 cell monolayers(Hickey and Cianciotto, 1997).
COG COG0735P, under P: Inorganic ion transport and metabolism
References
Hickey and Cianciotto, 1997: Hickey EK, Cianciotto NP. An iron- and fur-repressed Legionella pneumophila gene that promotes intracellular infection and encodes a protein with similarity to the Escherichia coli aerobactin synthetases. Infection and immunity. 1997; 65(1); 133-143. [PubMed: 8975903].