Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

mip from Legionella pneumophila str. Paris

Victor ID 1480
Gene Name mip from Legionella pneumophila str. Paris
Sequence Strain (Species/Organism) Legionella pneumophila str. Paris
NCBI Gene ID 3119248
NCBI Protein GI 54296815
Locus Tag lpp0855
Protein Accession YP_123184.1
Other Database IDs UniProtKB-ID: Q5X6V9_LEGPA
UniRef100: UniRef100_Q5ZXE0
UniRef90: UniRef90_Q5ZXE0
UniRef50: UniRef50_Q5ZXE0
UniParc: UPI0000001582
EMBL: CR628336
EMBL-CDS: CAH12005.1
RefSeq_NT: NC_006368.1
GenomeReviews: CR628336_GR
KEGG: lpp:lpp0855
LegioList: lpp0855
eggNOG: COG0545
HOGENOM: HBG731200
OMA: GLSIGNN
ProtClustDB: CLSK914199
BioCyc: LPNE297246:LPP0855-MONOMER
Taxonomy ID 297246
Gene Starting Position 959507
Gene Ending Position 960208
Gene Strand (Orientation) +
Protein Name macrophage infectivity potentiator
DNA Sequence
>gi|54295983:959507-960208 Legionella pneumophila str. Paris, complete genome
TATGAAGATGAAATTGGTGACTGCAGCTGTTATGGGGCTTGCAATGTCAACAGCAATGGCTGCAACCGAT
GCCACATCATTAGCTACAGACAAGGATAAGTTGTCTTATAGCATTGGTGCCGATTTGGGGAAGAATTTTA
AAAATCAAGGCATAGATGTTAATCCGGAAGCAATGGCTAAAGGCATGCAAGACGCTATGAGTGGCGCTCA
ATTGGCTTTAACCGAACAGCAAATGAAAGACGTTCTTAACAAGTTTCAGAAAGATTTGATGGCTAAGCGT
ACTGCTGAATTCAATAAGAAAGCGGATGAAAATAAAGTAAAAGGGGAAGCCTTTTTAACTGAAAACAAAA
ACAAGCCAGGCGTTGTTGTATTGCCAAGTGGTTTGCAATACAAAGTAATCAATTCTGGAAATGGTGTTAA
ACCCGGAAAATCGGATACAGTCACTGTCGAATATACTGGTCGTCTGATTGATGGTACCGTTTTTGACAGT
ACCGAAAAAACTGGTAAGCCAGCAACGTTCCAGGTTTCACAAGTTATCCCTGGATGGACAGAAGCTTTGC
AATTGATGCCAGCTGGATCAACTTGGGAAATTTATGTTCCCTCAGGTCTTGCATATGGCCCACGTAGCGT
TGGCGGACCTATTGGCCCAAATGAAACTTTAATATTTAAAATTCACTTAATTTCAGTGAAAAAATCATCT
TA
Protein Sequence
>gi|54296815|ref|YP_123184.1| macrophage infectivity potentiator [Legionella pneumophila str. Paris] MKMKLVTAAVMGLAMSTAMAATDATSLATDKDKLSYSIGADLGKNFKNQGIDVNPEAMAKGMQDAMSGAQLALTEQQMKDVLNKFQKDLMAKRTAEFNKKADENKVKGEAFLTENKNKPGVVVLPSGLQYKVINSGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKKSS
Molecule Role Virulence factor
Molecule Role Annotation MUTATION: mip mutants are approximately 50- to 100-fold less infective for A. castellanii and for human mononuclear phagocytes in vitro compared with their isogenic Mip-positive parental strains (Wintermeyer et al., 1995).
COG COG0545O, under O: Posttranslational modification, protein turnover, chaperones
References
Wintermeyer et al., 1995: Wintermeyer E, Ludwig B, Steinert M, Schmidt B, Fischer G, Hacker J. Influence of site specifically altered Mip proteins on intracellular survival of Legionella pneumophila in eukaryotic cells. Infection and immunity. 1995; 63(12); 4576-4583. [PubMed: 7591108].