Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

djlA from Legionella pneumophila str. Paris

Victor ID 1483
Gene Name djlA from Legionella pneumophila str. Paris
Sequence Strain (Species/Organism) Legionella pneumophila str. Paris
NCBI Gene ID 3119498
NCBI Protein GI 54298231
Locus Tag lpp2289
Protein Accession YP_124600.1
Other Database IDs UniProtKB-ID: Q5X2U8_LEGPA
UniRef100: UniRef100_Q5X2U8
UniRef90: UniRef90_Q9X772
UniRef50: UniRef50_Q9X772
UniParc: UPI00004450BA
EMBL: CR628336
EMBL-CDS: CAH13442.1
RefSeq_NT: NC_006368.1
GenomeReviews: CR628336_GR
KEGG: lpp:lpp2289
LegioList: lpp2289
eggNOG: COG1076
HOGENOM: HBG508481
OMA: LRACWRM
ProtClustDB: PRK09430
BioCyc: LPNE297246:LPP2289-MONOMER
Taxonomy ID 297246
Gene Starting Position 2630059
Gene Ending Position 2630949
Gene Strand (Orientation) +
Protein Name Dna-J like membrane chaperone protein
DNA Sequence
>gi|54295983:2630059-2630949 Legionella pneumophila str. Paris, complete genome
AATGAACTTACGTGATTTCTTTGTAATAACAACCTGGTGGGGAAAAATACTTGGTGCCTTCTTTGGCTAC
TTAACTGCTGGACCAGTAGGCGCTTTGTTTGGCATTCTCGTTGGAAACTTTTTTGATCGGGGCCTTGTCA
GTTATTACTCTAATCCCCATTGGCTGTACCATGCAGAAAAACAAAGAATCGTTCAAAAAGCTTTCTTTGA
AGCCACTTTCTCCATAATGGGGCATGTTGCGAAATCGGATGGACGTGTTTCTGAACAAGAGATTAGCATG
GCTAAATCCATCATGAATGAAATGAAATTGAGCAAGGGACAAAAAGATTTAGCAAAACGATTATTTAATG
AAGGGAAACAACCTGATTTCAATGTCAGCCTTGCTCTTATCCAATTACAAAGAATCTGCAAGGATAACCG
TGATTTGTTAAAGCTTTTTGTAGATATTCAGTATAGGGCAGCTCAAGTAGATGGATTAAGTAGCCAAAAA
ATTCATGCGCTAGATAACATTTTTACGCATCTGGGATTTGCTCCCTTACACAAGCAGTATCGTTTTTATG
AGGATTTTGGCTCTTATTTCCAGCAAGAACAATCCAAACAACACTATCATAATCAACAGGGGTACAAGCA
TACCTCCTCTTCTCAAGATCAACAGGGTTACAAACCTCAATCACCCCCTAATACTTTAGCGCACGCTTTT
GCATTGCTTGAGGTAAGTCCGAATGCAAGCAAACAGGAGGTTAGAAGAGCTTACAGACGCCTATTGAGCC
GTAACCATCCAGATAAATTAATTGCTCAAGGTTTACCCGAAGAAATGATTAAATTGGCTAACGATAAAAC
TCATCAAATTATGAAAGCCTATGAATTGATCTGTGAAACCAAGGGCTGGTA
Protein Sequence
>gi|54298231|ref|YP_124600.1| Dna-J like membrane chaperone protein [Legionella pneumophila str. Paris] MNLRDFFVITTWWGKILGAFFGYLTAGPVGALFGILVGNFFDRGLVSYYSNPHWLYHAEKQRIVQKAFFEATFSIMGHVAKSDGRVSEQEISMAKSIMNEMKLSKGQKDLAKRLFNEGKQPDFNVSLALIQLQRICKDNRDLLKLFVDIQYRAAQVDGLSSQKIHALDNIFTHLGFAPLHKQYRFYEDFGSYFQQEQSKQHYHNQQGYKHTSSSQDQQGYKPQSPPNTLAHAFALLEVSPNASKQEVRRAYRRLLSRNHPDKLIAQGLPEEMIKLANDKTHQIMKAYELICETKGW
Molecule Role Virulence factor
Molecule Role Annotation MUTATION: djlA mutant is attenuated in mouse macrophages (Vincent et al., 2006).
COG COG1076O, under O: Posttranslational modification, protein turnover, chaperones
References
Vincent et al., 2006: Vincent CD, Buscher BA, Friedman JR, Williams LA, Bardill P, Vogel JP. Identification of non-dot/icm suppressors of the Legionella pneumophila DeltadotL lethality phenotype. Journal of bacteriology. 2006; 188(23); 8231-8243. [PubMed: 16997951].