Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

mip from Legionella pneumophila str. Corby

Victor ID 1827
Gene Name mip from Legionella pneumophila str. Corby
Sequence Strain (Species/Organism) Legionella pneumophila str. Corby
NCBI Gene ID 5180329
NCBI Protein GI 148360557
Locus Tag LPC_2500
Protein Accession YP_001251764.1
Other Database IDs UniProtKB-ID: MIP_LEGPC
UniRef100: UniRef100_A5IGB8
UniRef90: UniRef90_A5IGB8
UniRef50: UniRef50_Q5ZXE0
UniParc: UPI00000010BA
EMBL: S72442
EMBL: CP000675
EMBL-CDS: AAB31083.1
EMBL-CDS: ABQ56418.1
RefSeq_NT: NC_009494.2
GenomeReviews: CP000675_GR
KEGG: lpc:LPC_2500
eggNOG: COG0545
HOGENOM: HBG731200
OMA: KLQYRIV
ProtClustDB: CLSK914199
BioCyc: LPNE400673:LPC_2500-MONOMER
Taxonomy ID 400673
Gene Starting Position 2717926
Gene Ending Position 2718627
Gene Strand (Orientation) -
Protein Name macrophage infectivity potentiator (Mip)
DNA Sequence
>gi|148358139:2717926-2718627 Legionella pneumophila str. Corby, complete genome
CTTAAGATGATTTTTTCACTGAAATTAAGTGAATTTTAAATATTAAAGTTTCATTTGGGCCAATAGGTCC
GCCAACGCTACGTGGGCCATATGCAAGACCTGAGGGAACATAAATTTCCCAAGTTGATCCAGCTGGCATC
AATTGCAAAGCTTCTGTCCATCCTGGGATAACTTGTGAAACCTGAAAAGTTGCTGGCTTACCAGTTTTTT
CGGTACTGTCAAAAACGGTACCATCAATCAGACGACCAGTGTATTCGACAGTGACTGTATCCGATTTACC
GGGTTTAACACCATTTCCAGCATTGATTACTTTGTATTGCAAACCACTTGGCAATACAACAACGCCTGGC
TTGTTTTTGTTTTCAGTTAAAAAGGCTTCCCCTTTTACTTTATTTTCATCCGCTTTCTTATTGAATTCAG
CAGTACGCTTTGCCATCAAATCTTTCTGAAACTTGTTAAGAACGTCTTTCATTTGCTGTTCGGTTAAAGC
CAATTGAGCGCCACTCATAGCGTCTTGCATGCCTTTAGCCATTGCTTCCGGATTAACATCTATGCCTTGA
TTTTTAAAATTCTTCCCCAAATCGGCACCAATGCTATAAGACAACTTATCCTTGTCTGTAGCTAATGATG
TGGCATCGGTTGCAGCCATTGCTGTTGACATTGCAAGCCCCATAACAGCCGCAGTCACCAATTTCATCTT
CA
Protein Sequence
>gi|148360557|ref|YP_001251764.1| macrophage infectivity potentiator [Legionella pneumophila str. Corby] MKMKLVTAAVMGLAMSTAMAATDATSLATDKDKLSYSIGADLGKNFKNQGIDVNPEAMAKGMQDAMSGAQLALTEQQMKDVLNKFQKDLMAKRTAEFNKKADENKVKGEAFLTENKNKPGVVVLPSGLQYKVINAGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKKSS
Molecule Role Virulence factor
Molecule Role Annotation MUTATION: mip mutants are approximately 50- to 100-fold less infective for A. castellanii and for human mononuclear phagocytes in vitro compared with their isogenic Mip-positive parental strains (Wintermeyer et al., 1995).
COG COG0545O, under O: Posttranslational modification, protein turnover, chaperones
References
Wintermeyer et al., 1995: Wintermeyer E, Ludwig B, Steinert M, Schmidt B, Fischer G, Hacker J. Influence of site specifically altered Mip proteins on intracellular survival of Legionella pneumophila in eukaryotic cells. Infection and immunity. 1995; 63(12); 4576-4583. [PubMed: 7591108].