Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

iraA from Legionella pneumophila str. Corby

Victor ID 1828
Gene Name iraA from Legionella pneumophila str. Corby
Sequence Strain (Species/Organism) Legionella pneumophila str. Corby
NCBI Gene ID 5180371
NCBI Protein GI 148360599
Locus Tag LPC_2545
Protein Accession YP_001251806.1
Other Database IDs UniProtKB-ID: A5IGG0_LEGPC
UniRef100: UniRef100_A5IGG0
UniRef90: UniRef90_A5IGG0
UniRef50: UniRef50_A5IGG0
UniParc: UPI00000BEBD5
EMBL: CP000675
EMBL-CDS: ABQ56460.1
RefSeq_NT: NC_009494.2
GenomeReviews: CP000675_GR
KEGG: lpc:LPC_2545
HOGENOM: HBG111510
ProtClustDB: CLSK832375
BioCyc: LPNE400673:LPC_2545-MONOMER
Taxonomy ID 400673
Gene Starting Position 2766419
Gene Ending Position 2767237
Gene Strand (Orientation) +
Protein Name small-molecule methyltransferase IraA
DNA Sequence
>gi|148358139:2766419-2767237 Legionella pneumophila str. Corby, complete genome
CATGTCCTTGAAGGCCATGTATAACCAAATCGCAGAAAATTACGCGACAGCTAATCGTTTTGGTTCAATT
AGTGAAAGCCATCACGTTGCCATTGAGCAGATGAGGAAATTTCATTTGGGGTTGAAACCCCATTATAAAA
TCCTCGATCTGGGCGTTGGCAATGGTTCTTTTTTGCAAAAATTGCATCACTTAATGCCAATGGCTAATTT
CACAGGAATTGATGTTTCATCAGAAATGTTAAAACGAGCGAGCGAAGCCCTTCCTTTAACAACCATTGAA
GGCAGTGCTGCAGAAGCCAACAAGTTTTTGCCCGCGCATAGCCAGGACTTGGTTCTGGCTCATTTTATCA
ATGCTTATATCCCCATTAATGTTCTCTTTGATGAAGCCAAATACTTGACGCGCGCCAACGGTCACTTCTC
TTTAATCACAACAACCTATGATTCTTTTCCTGTAGCGCAACAACAACTGGCCAACTTCATTGCTCAGGAT
ACTATTTTAAGCCGAGTTGTTGGTCACTACTATAAATCCATAGTTAAAAATACGACTGTTGCTGCAAATC
TCGATGAACTCTTGCTGGCATTTAAACAGCATCAATTTAATATTTTGGATCACCAACGTATTGAAATACC
CATTACCCTTAATAACATTGATGAATTGGCACTGTTTGGAATAGAGGGCACCTGGTTTCTTAACACTCTA
TCGATACGCATGCTGCCAAAATATTTTTTAATTCAGCGTCTTAAACGACTTTTCAGCAAAATCTTTACTT
TTCCCTACCATGACACTCATATTATTGATGTAGTTCTTGCCAGGAAGTG
Protein Sequence
>gi|148360599|ref|YP_001251806.1| small-molecule methyltransferase IraA [Legionella pneumophila str. Corby] MSLKAMYNQIAENYATANRFGSISESHHVAIEQMRKFHLGLKPHYKILDLGVGNGSFLQKLHHLMPMANFTGIDVSSEMLKRASEALPLTTIEGSAAEANKFLPAHSQDLVLAHFINAYIPINVLFDEAKYLTRANGHFSLITTTYDSFPVAQQQLANFIAQDTILSRVVGHYYKSIVKNTTVAANLDELLLAFKQHQFNILDHQRIEIPITLNNIDELALFGIEGTWFLNTLSIRMLPKYFLIQRLKRLFSKIFTFPYHDTHIIDVVLARK
Molecule Role Virulence factor
Molecule Role Annotation MUTATION: iraA mutant is attenuated in guinea pigs (Viswanathan et al., 2000).
COG COG2226H, under H: Coenzyme transport and metabolism
References
Viswanathan et al., 2000: Viswanathan VK, Edelstein PH, Pope CD, Cianciotto NP. The Legionella pneumophila iraAB locus is required for iron assimilation, intracellular infection, and virulence. Infection and immunity. 2000; 68(3); 1069-1079. [PubMed: 10678909].