Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

rpoS from Legionella pneumophila str. Corby

Victor ID 1829
Gene Name rpoS from Legionella pneumophila str. Corby
Sequence Strain (Species/Organism) Legionella pneumophila str. Corby
NCBI Gene ID 5180541
NCBI Protein GI 148358826
Locus Tag LPC_0709
Protein Accession YP_001250033.1
Other Database IDs UniProtKB-ID: A5IBD7_LEGPC
UniRef100: UniRef100_A5IBD7
UniRef90: UniRef90_Q5ZW04
UniRef50: UniRef50_P35540
UniParc: UPI0001527C2A
EMBL: CP000675
EMBL-CDS: ABQ54687.1
RefSeq_NT: NC_009494.2
GenomeReviews: CP000675_GR
KEGG: lpc:LPC_0709
eggNOG: COG0568
HOGENOM: HBG745096
OMA: LEAPARE
ProtClustDB: CLSK832699
BioCyc: LPNE400673:LPC_0709-MONOMER
Taxonomy ID 400673
Gene Starting Position 758558
Gene Ending Position 759583
Gene Strand (Orientation) +
Protein Name stationary phase specific sigma factor RpoS
DNA Sequence
>gi|148358139:758558-759583 Legionella pneumophila str. Corby, complete genome
AATGCAAGATGAAGAAGAGCCAATTAAGGACAAGGAATTTAAAGAAGAGGAATGGTCTGAGCCAGATGAT
GACTCTCTGTTGTCAGAAGAAGATGTTGAACCTGATATCGAAAAAATGGAAGAAGATCTTGATGAATTTC
CAGAGTTTACTGATGATGAAGTTTTTCCTTCATTTCAGCGCGGGAAAAACATTGCTAAGGCTTTAGATGC
GACTCAACTTTACTTGGGTGAAATTGGCTTTTCTCCTTTGTTAACGGCTGAAGAAGAAATCCATTATGCG
ACTCTTGCTTTAAAAGGTGATATGGAAGCACGCAAGAAAATGATTGAGTCGAATTTGCGCCTGGTGGTTA
AAATAGCCAGACGTTATCTTAATAGAGGATTACCTCTTCTGGATCTAATCGAAGAGGGTAACCTGGGTTT
AATGAAGTCTGTTGAGAAATTTGACCCCAAGCGAGGATTCCGTTTTTCAACTTATGCGACCTGGTGGATT
AGGCAAACTATTGAGCGCGCAATTATGAATCAAACGAGAACTATCCGCTTGCCTATTCATGTCGTGAAAG
AACTTAATGTTTATCTCAGAGCAGCAAGACAATTGACGCAAAAACTGGATCATGAACCATCACCTGAAGA
AATAGCAGAAATGGTGGATAAGCCTTTGGAGGATGTCCAAAAATTATTGGGATTGAATGATAAAGTGGCT
TCAGTTGATACTCCAATTGGATTTGATGAAACCAAATCTTTATTAGATACAATTGCTGATGAAAACAGTT
TAAATCCTGCAGAGCTGCTAACCAATGAGAATTTAAGGCAGCATATAGAATCTCTTCTGGATAAATTAAC
TGAGAATCAACAGCAGGTTATCGCAAGACGTTTTGGGTTAAGAGGTTTTGAAAAAGCGACTCTGGAAGAC
GTTGGTAAGGAAATTGATTTGACCCGAGAACGCGTTCGCCAAATTCAAGTTGAAGCTTTGAAGACACTTA
GAACTTTGTTAGAGCGGGTTGGACTAACACAAGAGGATTTGTTTTG
Protein Sequence
>gi|148358826|ref|YP_001250033.1| stationary phase specific sigma factor RpoS [Legionella pneumophila str. Corby] MQDEEEPIKDKEFKEEEWSEPDDDSLLSEEDVEPDIEKMEEDLDEFPEFTDDEVFPSFQRGKNIAKALDATQLYLGEIGFSPLLTAEEEIHYATLALKGDMEARKKMIESNLRLVVKIARRYLNRGLPLLDLIEEGNLGLMKSVEKFDPKRGFRFSTYATWWIRQTIERAIMNQTRTIRLPIHVVKELNVYLRAARQLTQKLDHEPSPEEIAEMVDKPLEDVQKLLGLNDKVASVDTPIGFDETKSLLDTIADENSLNPAELLTNENLRQHIESLLDKLTENQQQVIARRFGLRGFEKATLEDVGKEIDLTRERVRQIQVEALKTLRTLLERVGLTQEDLF
Molecule Role Virulence factor
Molecule Role Annotation MUTATION: rpoS mutant has defective intracellular replication in its protozoan host (Hovel-Miner et al., 2009).
COG COG0568K, under K: Transcription
References
Hovel-Miner et al., 2009: Hovel-Miner G, Pampou S, Faucher SP, Clarke M, Morozova I, Morozov P, Russo JJ, Shuman HA, Kalachikov S. SigmaS controls multiple pathways associated with intracellular multiplication of Legionella pneumophila. Journal of bacteriology. 2009; 191(8); 2461-2473. [PubMed: 19218380].