Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

cpxR from Legionella pneumophila str. Corby

Victor ID 1830
Gene Name cpxR from Legionella pneumophila str. Corby
Sequence Strain (Species/Organism) Legionella pneumophila str. Corby
NCBI Gene ID 5180685
NCBI Protein GI 148358969
Locus Tag LPC_0854
Protein Accession YP_001250176.1
Other Database IDs UniProtKB-ID: A5IBT0_LEGPC
UniRef100: UniRef100_A5IBT0
UniRef90: UniRef90_D3HTB6
UniRef50: UniRef50_A9FFH2
UniParc: UPI0000444D90
EMBL: CP000675
EMBL-CDS: ABQ54830.1
RefSeq_NT: NC_009494.2
GenomeReviews: CP000675_GR
KEGG: lpc:LPC_0854
eggNOG: COG0745
HOGENOM: HBG753323
OMA: THSQANE
ProtClustDB: CLSK832796
BioCyc: LPNE400673:LPC_0854-MONOMER
Taxonomy ID 400673
Gene Starting Position 918544
Gene Ending Position 919224
Gene Strand (Orientation) -
Protein Name transcriptional regulatory protein CpxR
DNA Sequence
>gi|148358139:918544-919224 Legionella pneumophila str. Corby, complete genome
GCTACGCATTAAACATGTACCCAAACCCGCGGACAGTTTTGACTAAAGGTTCTCCCTGAGGATTATCGCC
TAATTTATTTCGTAAATTGCTGATGTGAACATCGATACTGCGGTCATAAGCAGTGTATTTTCTTCCCAGA
GCATATTCGGTGAGTTCCTCTTTGGAAAATGCTTGTCCTGGTGATTTGATTAACATCTCTAAAATATTAA
ATTCCGCATTGGTTAATTCAAGGAATTTTCCTCCCATAGTCACGTGGCGTTTGGAGCAATCCACAATGAT
ATTATGTTGTTCAATAATTGGTTTGGGAGTTGGGATTTTTTGAGTGCGTCTTAAAATAGCACGCAGACGT
GCAACTAACTCTCGTGGATTACAAGGTTTAGGTAAGTAATCATCTGCACCAATTTCTAACCCAACAATGC
GATCGATATCATCACCACGAGCAGTTAACATCAATACAGGTGTTTCCAAATGCTCTCTTATTGCTTTTAA
TACTTCAAAACCATTAAGCTTGGGCAGCATGACGTCGAGTATAATGGCATCAAATACCTGATTTAAAGCT
TTTTTAACACCATTTTCTCCATCATGCACACATACTACATTAAAGCCTTCTGGCTCCAAATATTGGGTTA
ATAAATCTGTTAGTTCTGTGTCATCATCAATAATGAGAATAGAGCTGCTCA
Protein Sequence
>gi|148358969|ref|YP_001250176.1| transcriptional regulator CpxR [Legionella pneumophila str. Corby] MSSSILIIDDDTELTDLLTQYLEPEGFNVVCVHDGENGVKKALNQVFDAIILDVMLPKLNGFEVLKAIREHLETPVLMLTARGDDIDRIVGLEIGADDYLPKPCNPRELVARLRAILRRTQKIPTPKPIIEQHNIIVDCSKRHVTMGGKFLELTNAEFNILEMLIKSPGQAFSKEELTEYALGRKYTAYDRSIDVHISNLRNKLGDNPQGEPLVKTVRGFGYMFNA
Molecule Role Virulence factor
Molecule Role Annotation MUTATION: cpxR mutant is attenuated in mouse macrophages (Vincent et al., 2006).
COG COG0745TK, under T: Signal transduction mechanisms; K: Transcription
References
Vincent et al., 2006: Vincent CD, Buscher BA, Friedman JR, Williams LA, Bardill P, Vogel JP. Identification of non-dot/icm suppressors of the Legionella pneumophila DeltadotL lethality phenotype. Journal of bacteriology. 2006; 188(23); 8231-8243. [PubMed: 16997951].