Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

djlA from Legionella pneumophila str. Corby

Victor ID 1832
Gene Name djlA from Legionella pneumophila str. Corby
Sequence Strain (Species/Organism) Legionella pneumophila str. Corby
NCBI Gene ID 5181617
NCBI Protein GI 148359881
Locus Tag LPC_1809
Protein Accession YP_001251088.1
Other Database IDs UniProtKB-ID: A5IEE2_LEGPC
UniRef100: UniRef100_A5IEE2
UniRef90: UniRef90_Q9X772
UniRef50: UniRef50_Q9X772
UniParc: UPI00015278D4
EMBL: CP000675
EMBL-CDS: ABQ55742.1
RefSeq_NT: NC_009494.2
GenomeReviews: CP000675_GR
KEGG: lpc:LPC_1809
eggNOG: COG1076
HOGENOM: HBG508481
OMA: LRACWRM
ProtClustDB: PRK09430
BioCyc: LPNE400673:LPC_1809-MONOMER
Taxonomy ID 400673
Gene Starting Position 2023509
Gene Ending Position 2024399
Gene Strand (Orientation) +
Protein Name Dna-J like membrane chaperone protein
DNA Sequence
>gi|148358139:2023509-2024399 Legionella pneumophila str. Corby, complete genome
AATGAACTTACGCGATTTCTTTGTAATAACAACCTGGTGGGGAAAAATACTTGGTGCCTTCTTTGGCTAC
TTAACTGCTGGACCAGTAGGCGCTTTGTTTGGCATTCTCGTTGGAAATTTTTTTGATCGGGGCCTTGTCA
GTTATTACTCTAATCCCCATTGGCTGTACCATGCAGAAAAACAAAGAATCGTTCAAAAAGCTTTCTTTGA
AGCCACTTTCTCCATAATGGGGCACGTTGCGAAATCGGATGGCCGTGTTTCTGAACAAGAGATTAGCATG
GCTAAATCCATCATGAATGAAATGAAATTGAGCAAGGGACAAAAAGATTTGGCAAAACGATTATTTAATG
AAGGGAAACAACCTGATTTCAATGTCAGTCTTGCCCTTATCCAATTACAAAGAATCTGCAAGGATAACCG
TGATTTGTTAAAGCTTTTTGTAGATATTCAGTATAGGGCAGCTCAAGTAGATGGATTAAGTAGCCAAAAA
ATTCACGCACTAGATAACATTTTTACGCATCTAGGATTTGCTCCCTTACACAAACAGTATCGTTTTTATG
AGGATTTTGGTTCTTATTTCCAGCAAGAACAATCCAAACAACACTATCATAATCAACAGGGGTACAAGCA
TACCTCCTCATCTCAAGGTCAACAGGGTTACAAACCTCAATCACCCCCTAATACTTTAGCGCATGCTTTT
GCATTACTTGAGGTAAGTCCGAATGCAAACAAACAGGAGGTTAGAAGAGCGTACAGACGTCTATTAAGCC
GTAACCATCCAGATAAATTAATTGCTCAAGGTTTACCCGAAGAAATGATTAAACTGGCTAACGATAAAAC
TCATCAAATTATGAAAGCCTATGAATTGATCTGTGAAACCAAGGGTTGGTA
Protein Sequence
>gi|148359881|ref|YP_001251088.1| DNA binding protein DnaJ, heat shock protein [Legionella pneumophila str. Corby] MNLRDFFVITTWWGKILGAFFGYLTAGPVGALFGILVGNFFDRGLVSYYSNPHWLYHAEKQRIVQKAFFEATFSIMGHVAKSDGRVSEQEISMAKSIMNEMKLSKGQKDLAKRLFNEGKQPDFNVSLALIQLQRICKDNRDLLKLFVDIQYRAAQVDGLSSQKIHALDNIFTHLGFAPLHKQYRFYEDFGSYFQQEQSKQHYHNQQGYKHTSSSQGQQGYKPQSPPNTLAHAFALLEVSPNANKQEVRRAYRRLLSRNHPDKLIAQGLPEEMIKLANDKTHQIMKAYELICETKGW
Molecule Role Virulence factor
Molecule Role Annotation MUTATION: djlA mutant is attenuated in mouse macrophages (Vincent et al., 2006).
COG COG1076O, under O: Posttranslational modification, protein turnover, chaperones
References
Vincent et al., 2006: Vincent CD, Buscher BA, Friedman JR, Williams LA, Bardill P, Vogel JP. Identification of non-dot/icm suppressors of the Legionella pneumophila DeltadotL lethality phenotype. Journal of bacteriology. 2006; 188(23); 8231-8243. [PubMed: 16997951].