Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

icmX from Legionella pneumophila str. Corby

Victor ID 1833
Gene Name icmX from Legionella pneumophila str. Corby
Sequence Strain (Species/Organism) Legionella pneumophila str. Corby
NCBI Gene ID 5182246
NCBI Protein GI 148358575
Locus Tag LPC_0447
Protein Accession YP_001249782.1
Other Database IDs UniProtKB-ID: A5IAN6_LEGPC
UniRef100: UniRef100_A5IAN6
UniRef90: UniRef90_Q5WTA9
UniRef50: UniRef50_Q5X1K0
UniParc: UPI0001527D4A
EMBL: CP000675
EMBL-CDS: ABQ54436.1
RefSeq_NT: NC_009494.2
GenomeReviews: CP000675_GR
KEGG: lpc:LPC_0447
HOGENOM: HBG520266
OMA: QINDASP
ProtClustDB: CLSK833558
BioCyc: LPNE400673:LPC_0447-MONOMER
Taxonomy ID 400673
Gene Starting Position 477848
Gene Ending Position 479257
Gene Strand (Orientation) -
Protein Name Intracellular multiplication protein IcmX
DNA Sequence
>gi|148358139:477848-479257 Legionella pneumophila str. Corby, complete genome
ACTATTGTTGCTCAGAGGGAGAGCTTTGGTTTGAAAAATCTGCGGTCGGTTGGGCTGCTTTTAAGTTTTG
CAATAACATAATGCTGTTGGTTAACAATATCCGTTCTTGTATTTGTCTGTCCAAATACATTTGATAATTA
ATTTCAGCCAGCAATACTGCTATTTCTTTTTGAACTGTGGCAGGGGATGCGTCATTAATTTGTTTAATCC
ATTGTTGGTTTGGTTGTCCGGGAGTGTTGGAGGCGGTTGGATCAAATAATCGTCGAGTTGCCATGTTAAA
TTCATTCAACGCCTGACTTGTGATATTGGAACTATTTTGGTCTCCACTCATATTTTGGGGTAATCTTTTG
GATAAAATATAATAGAGATTACTCACGCCTACAGAAGTTTGTGCGGCGTAAACGCGCAAATTATTAAAAT
AACCGCTCAATGTTGCCGCCGCTTGTTTTTGCTGGACTTCATTATAACCTTGGGAACCTGGTTCAGCCTT
AGCCTGATTCCATAACTCAGTGTAGGCGCTCAACTTGGGCAAGGAAGGAGGAGTGACTTGAGCGCTGGCG
TATCTAATAAAATTAAGCGCTTGCTGGGCTTGGGTTTGTGCCTTTAATCCGGATTTTTGTTCTGATTGTG
CCGCAGAGGTATCCAGGAGTAATGGCGCAATCAAAGAGTTACTGTTCAGTTGGCTTATGAGCGGTTTATT
GTACGTGTAGCTATAAAAAGGTTCCAGCGAGCTTTGATTAGGCAAGGCTGGAGGTAAAGTGCCAATTATA
TTTTGCATGACCAGATTTTGATACATCAGGTTGCAATTTGGCAACCAGTTTTTTTGCTCATTGTCCATAC
AAAAACTGTAATCCGGGGTTCCCAGAATATTGAATACTGCCTGACTGACGGGATCATTTAAATAAGTCCC
GGAGGTTGGGATTTGTATGGCAGAAAAAACCCCGGAAGGAGTGGGGGCTTGAGCACTGGTTGTTGATTGA
TCTATTAAACCATTAGCGGTAATTTTTCCATCTGACCCGGATGATGGGGAGCTGAAGTTTTGATATTTAA
AGGTGCTGTTTGCCAAGTTATTTATTAATGCATTTCCTTGCACCTTATTGGTGACGAAATTCATTAAGCT
CTGTGACATGGCATCGACAGGAATAGCGCCCAAAAAGGTATTGTAAGCGTAATTTTGAATGAGTTGGGCT
ACATTGGAATTAAATAGCTGTGAATAAGGCGGAGTTGGTGGTTTGCCCTTTTCAGTAATATCATAGCCTA
AATATTTCCCCAGATTCGTCAGGTAAGTTACCAGGCTATTCGTGTTTTTGCTTGTCTGTTGATCATACGT
GTCATAACCCTGTTGAGCAAAAACAGATAAGGTGGTAAAACAAAACAGATTGGCCAAGGCCAGTTTAGGT
AATACTTTCA
Protein Sequence
>gi|148358575|ref|YP_001249782.1| intracellular multiplication protein IcmX [Legionella pneumophila str. Corby] MKVLPKLALANLFCFTTLSVFAQQGYDTYDQQTSKNTNSLVTYLTNLGKYLGYDITEKGKPPTPPYSQLFNSNVAQLIQNYAYNTFLGAIPVDAMSQSLMNFVTNKVQGNALINNLANSTFKYQNFSSPSSGSDGKITANGLIDQSTTSAQAPTPSGVFSAIQIPTSGTYLNDPVSQAVFNILGTPDYSFCMDNEQKNWLPNCNLMYQNLVMQNIIGTLPPALPNQSSLEPFYSYTYNKPLISQLNSNSLIAPLLLDTSAAQSEQKSGLKAQTQAQQALNFIRYASAQVTPPSLPKLSAYTELWNQAKAEPGSQGYNEVQQKQAAATLSGYFNNLRVYAAQTSVGVSNLYYILSKRLPQNMSGDQNSSNITSQALNEFNMATRRLFDPTASNTPGQPNQQWIKQINDASPATVQKEIAVLLAEINYQMYLDRQIQERILLTNSIMLLQNLKAAQPTADFSNQSSPSEQQ
Molecule Role Virulence factor
Molecule Role Annotation MUTATION: icmX mutant is attenuated in guinea pigs (Edelstein et al., 1999).
References
Edelstein et al., 1999: Edelstein PH, Edelstein MA, Higa F, Falkow S. Discovery of virulence genes of Legionella pneumophila by using signature tagged mutagenesis in a guinea pig pneumonia model. Proceedings of the National Academy of Sciences of the United States of America. 1999; 96(14); 8190-8195. [PubMed: 10393970].