Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

dotB from Legionella pneumophila str. Corby

Victor ID 1835
Gene Name dotB from Legionella pneumophila str. Corby
Sequence Strain (Species/Organism) Legionella pneumophila str. Corby
NCBI Gene ID 5182260
NCBI Protein GI 148358589
Locus Tag LPC_0461
Protein Accession YP_001249796.1
Other Database IDs UniProtKB-ID: A5IAQ0_LEGPC
UniRef100: UniRef100_Q5ZS43
UniRef90: UniRef90_Q5ZS43
UniRef50: UniRef50_Q5ZS43
UniParc: UPI0001527DD9
EMBL: CP000675
EMBL-CDS: ABQ54450.1
RefSeq_NT: NC_009494.2
GenomeReviews: CP000675_GR
KEGG: lpc:LPC_0461
eggNOG: COG2805
HOGENOM: HBG757455
OMA: IISERVY
ProtClustDB: CLSK914927
BioCyc: LPNE400673:LPC_0461-MONOMER
Taxonomy ID 400673
Gene Starting Position 494034
Gene Ending Position 495143
Gene Strand (Orientation) -
Protein Name defect in organelle trafficking protein DotB (ATPase)
DNA Sequence
>gi|148358139:494034-495143 Legionella pneumophila str. Corby, complete genome
ATTATTGTTGATATTCTTTGGCCCCAGCAATGATTAATTTATAAACTCGCTCACTGATAATCCCCTGTTC
AAATTTCATTTTTGCGTCCCAAGTCATTAACTGCCCTTTTTGCCTCACTAACTTACGAGTGGCTGAAGTC
ACTTCGTTAGGGTCTCCCTCCAATAGAATATCTCTCACTTCTTCATCGAATACCAGATACTCCCTTAGGG
CTACACGTCTTTCATCAACGGTTGGGACCAGTTTTTGCCAAATGCAAAGCCTAATTGTTTCAAGAATATC
GATGGTTCTTCCCAAACGCTCTTCCCCGCTAAAAGATGTGACCAGACGTCGCATTGTTTCTGCAACACCA
GAAGTATGCAGGGTTGTGTAGACAGGGTGCCCTGTTAAAGCGGCTTCAAGAGCGGCACTGATGGTTTCTG
CATCACGACATTCACCCACCATAATTAATCTTGGCTTTCGTCTTAATGCGTTTCTTACTCCATCAGCAAA
GTTGGGTAAGTGTCTTGGAATCTCTGATTGGCTTACTACAGCGGAAATTGTTTCAATTTCATCATAGACG
AATTCTATCGGGGATTCGTAAGTTAATACTTTACGGTTTGAGTCTGATGTTTCAATAAGTTCTCGAATAA
TGGAAGCTAACAATGTTGATTTGCCCGAACCGGTAGCGCCTGTAATAAACACGATTCCTTCCTGTGGAGC
AATCGCTTCAATAATGTTATCAGGGAGGTTCATGGTACTGAGTTTGGGTGGCGTGGTTGGAATAGTTCTT
AATGTGATTTGAATGGCATCATGACCTTCAACCAGGCAGGCAGTCGCGTTAACCCTATATCGATAGCGTA
CACCACGGTTGGGTCGGAACTCATAATGAGTATCTATATCTTTACCGGAAAGTAATTGTGTCGTGGCATT
CGGGCCATAAATGGAATTAATAAGGTCGCCCAATTCTGTATTGGAAAGACGTCGATTTGTAATTTTAAGG
AGTCTTCCATAAACCTCTGCAAAAATGGGTTCGCCAGTTTGGATTGTTATATCTGAAGCATTCAGGCTTT
CTGCATGCTCCAGCATTCTGTCCATGAATACTGGAGTGAAACGAGTTGGCTCATCGGGCA
Protein Sequence
>gi|148358589|ref|YP_001249796.1| organelle trafficking lipoprotein defect DotB [Legionella pneumophila str. Corby] MPDEPTRFTPVFMDRMLEHAESLNASDITIQTGEPIFAEVYGRLLKITNRRLSNTELGDLINSIYGPNATTQLLSGKDIDTHYEFRPNRGVRYRYRVNATACLVEGHDAIQITLRTIPTTPPKLSTMNLPDNIIEAIAPQEGIVFITGATGSGKSTLLASIIRELIETSDSNRKVLTYESPIEFVYDEIETISAVVSQSEIPRHLPNFADGVRNALRRKPRLIMVGECRDAETISAALEAALTGHPVYTTLHTSGVAETMRRLVTSFSGEERLGRTIDILETIRLCIWQKLVPTVDERRVALREYLVFDEEVRDILLEGDPNEVTSATRKLVRQKGQLMTWDAKMKFEQGIISERVYKLIIAGAKEYQQ
Molecule Role Virulence factor
Molecule Role Annotation MUTATION: dotB mutant is attenuated in guinea pigs (Edelstein et al., 1999).
COG COG2805NU, under N: Cell motility; U: Intracellular trafficking, secretion, and vesicular transport
References
Edelstein et al., 1999: Edelstein PH, Edelstein MA, Higa F, Falkow S. Discovery of virulence genes of Legionella pneumophila by using signature tagged mutagenesis in a guinea pig pneumonia model. Proceedings of the National Academy of Sciences of the United States of America. 1999; 96(14); 8190-8195. [PubMed: 10393970].