Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

icmG from Legionella pneumophila str. Corby

Victor ID 1839
Gene Name icmG from Legionella pneumophila str. Corby
Sequence Strain (Species/Organism) Legionella pneumophila str. Corby
NCBI Gene ID 5182669
NCBI Protein GI 148360931
Locus Tag LPC_2891
Protein Accession YP_001252138.1
Other Database IDs UniProtKB-ID: A5IHE2_LEGPC
UniRef100: UniRef100_D5T8L5
UniRef90: UniRef90_Q5ZYC0
UniRef50: UniRef50_D3HL98
UniParc: UPI0001527C04
EMBL: CP000675
EMBL-CDS: ABQ56792.1
RefSeq_NT: NC_009494.2
GenomeReviews: CP000675_GR
KEGG: lpc:LPC_2891
eggNOG: NOG84452
HOGENOM: HBG520087
OMA: IARQSEV
ProtClustDB: CLSK914912
BioCyc: LPNE400673:LPC_2891-MONOMER
Taxonomy ID 400673
Gene Starting Position 3151025
Gene Ending Position 3151831
Gene Strand (Orientation) -
Protein Name IcmG (DotF)
DNA Sequence
>gi|148358139:3151025-3151831 Legionella pneumophila str. Corby, complete genome
CTCAACTATCTTCTTGACTAAACTTAATCACTTGTCCAGAACTTGTTAAAATACGACCTTGCAAAGAATC
AATTAATTTAACCATTCCATATCCTGGAATTTTTGATCCCTCTCTAACTGTAAGTGTAGAACCATTTGAG
CCAATTAGCCAAGCCCGACCTGGAATTACTGCTTGTATGTAATAAATAATTCTTACAGGAACTGTTGGCC
GAGATACTTTTACAACTTTCTTAGGAGTTGTACGCGCCATTAAGACATTAATCACTTCTGATTGTCTAGC
TATTTGATTTGACATATTACCAATAATTTGATTCAGATTTACAATTTGAGCATTTAAATTTTTGATATTG
TTATTTACTGCATTGATTTGTTCACCAAGCGCATTAACCTCCGAACGAAGACTCTGTTGTGTCAGTTCTA
TTGCTGAAACTTTCTTCTTCAGATCGGGATCATCTTCAATAATAGTCGTAGGCTGAACCTGTTGTATGGG
AGTGGTAGTTGGTATTGTCTGTACAGGCTGTGGTGTTGCTACCTGTGTCACTGGAGGAATAGCGGGCTTT
GTGGTTACTTGGCTGGATTTATCTGAGAAAAACATCCAACCAATTATTTTATACATCACCATTATAAATA
CAACTGCCCCAATAGCAATAAGAGCGTTTCGCTTAATATCTTTTTTCTTTGTTAATCCCTCTTTCCCAGA
TTGAAACGAAGCTTCTGAATCGAGATCCGATTCACCAGCCTGATCCATATCGTATGAGTCAAGTTCTGCA
AATTTATATTCATCATTATTTTGATCGTGCTCTGCCA
Protein Sequence
>gi|148360931|ref|YP_001252138.1| hypothetical protein LPC_2891 [Legionella pneumophila str. Corby] MAEHDQNNDEYKFAELDSYDMDQAGESDLDSEASFQSGKEGLTKKKDIKRNALIAIGAVVFIMVMYKIIGWMFFSDKSSQVTTKPAIPPVTQVATPQPVQTIPTTTPIQQVQPTTIIEDDPDLKKKVSAIELTQQSLRSEVNALGEQINAVNNNIKNLNAQIVNLNQIIGNMSNQIARQSEVINVLMARTTPKKVVKVSRPTVPVRIIYYIQAVIPGRAWLIGSNGSTLTVREGSKIPGYGMVKLIDSLQGRILTSSGQVIKFSQEDS
Molecule Role Virulence factor
Molecule Role Annotation MUTATION: icmG mutant is attenuated in mice (Edelstein et al., 1999).
References
Edelstein et al., 1999: Edelstein PH, Edelstein MA, Higa F, Falkow S. Discovery of virulence genes of Legionella pneumophila by using signature tagged mutagenesis in a guinea pig pneumonia model. Proceedings of the National Academy of Sciences of the United States of America. 1999; 96(14); 8190-8195. [PubMed: 10393970].