Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

fur from Legionella pneumophila str. Corby

Victor ID 1840
Gene Name fur from Legionella pneumophila str. Corby
Sequence Strain (Species/Organism) Legionella pneumophila str. Corby
NCBI Gene ID 5182750
NCBI Protein GI 148361012
Locus Tag LPC_2972
Protein Accession YP_001252219.1
Other Database IDs UniProtKB-ID: A5IHM3_LEGPC
UniRef100: UniRef100_Q48835
UniRef90: UniRef90_Q48835
UniRef50: UniRef50_Q48835
UniParc: UPI000012AD80
EMBL: CP000675
EMBL-CDS: ABQ56873.1
RefSeq_NT: NC_009494.2
GenomeReviews: CP000675_GR
KEGG: lpc:LPC_2972
eggNOG: COG0735
HOGENOM: HBG731501
OMA: YGVCTND
ProtClustDB: CLSK914682
BioCyc: LPNE400673:LPC_2972-MONOMER
Taxonomy ID 400673
Gene Starting Position 3228797
Gene Ending Position 3229207
Gene Strand (Orientation) -
Protein Name Ferric uptake regulation protein
DNA Sequence
>gi|148358139:3228797-3229207 Legionella pneumophila str. Corby, complete genome
GTCATTGACACTGCGGACATATACCATATATGTTTAGCGCATGATCTGTCATTTTAAAATGAGCACGTTC
GGCAATTGCTTTTTGTCTTTGTTCTATTATTTCATCTACAAATTCCTCTACCCGCCCACACTTAACACAA
ACAAGATGGTCATGATGTTCGCCCTGAGACAACTCAAACACCGAGTGTCCTCCTTCAAAATTATGTCTCG
ATACTAATCCGGCTGCTTCAAATTGAGTAAGAACTCTATACACAGTAGCTAAACCAACATCCTCACCGGA
TTCCAATAAGGCTTTATAGACTGCTTCTGCACTCAAATGATGGTTTCTTGATTGCTCCAATATTTGCAAT
ACCTTGATACGAGGTAATGTGATTTTTAATCCAGCGTCTTTTAACTGTTGACTCTCTTCCA
Protein Sequence
>gi|148361012|ref|YP_001252219.1| ferric uptake regulation protein [Legionella pneumophila str. Corby] MEESQQLKDAGLKITLPRIKVLQILEQSRNHHLSAEAVYKALLESGEDVGLATVYRVLTQFEAAGLVSRHNFEGGHSVFELSQGEHHDHLVCVKCGRVEEFVDEIIEQRQKAIAERAHFKMTDHALNIYGICPQCQ
Molecule Role Virulence factor
Molecule Role Annotation MUTATION: fur mutant is attenuated in growth within U937 cell monolayers (Hickey and Cianciotto, 1997).
COG COG0735P, under P: Inorganic ion transport and metabolism
References
Hickey and Cianciotto, 1997: Hickey EK, Cianciotto NP. An iron- and fur-repressed Legionella pneumophila gene that promotes intracellular infection and encodes a protein with similarity to the Escherichia coli aerobactin synthetases. Infection and immunity. 1997; 65(1); 133-143. [PubMed: 8975903].