Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

BPSS2053

Victor ID 1989
Gene Name BPSS2053
Sequence Strain (Species/Organism) Burkholderia pseudomallei K96243
NCBI Gene ID 3096991
NCBI Protein GI 53723070
Locus Tag BPSS2053
Genbank Accession BX571966
Protein Accession YP_112055
Other Database IDs UniProtKB-ID: Q63IL7_BURPS
UniRef100: UniRef100_Q63IL7
UniRef90: UniRef90_C4I9V1
UniRef50: UniRef50_A3P921
UniParc: UPI000043BF1E
EMBL: BX571966
EMBL-CDS: CAH39531.1
RefSeq_NT: NC_006351.1
GenomeReviews: BX571966_GR
KEGG: bps:BPSS2053
NMPDR: fig|272560.3.peg.2195
HOGENOM: HBG371030
OMA: GKTVDFM
ProtClustDB: CLSK711217
BioCyc: BPSE272560:BPSS2053-MONOMER
Taxonomy ID 272560
Chromosome No 2
Gene Starting Position 2770765
Gene Ending Position 2780076
Gene Strand (Orientation) -
Protein Name cell surface protein
Protein pI 5.25
Protein Weight 283051.18
Protein Length 3103
Protein Note Similar to Ralstonia solanacearum probable hemagglutinin-related protein Rsc1775 or Rs04371 SWALL:Q8XYI3 (EMBL: AL646066) (3165 aa) fasta scores: E(): 3.8e-164, 33.54% id in 3258 aa, and to Yersinia pestis putative adhesin Ypo0599 or y3579 SWALL:Q8ZIA8 (EMBL: AJ414143) (3295 aa) fasta scores: E(): 3.1e-62, 30.38% id in 3383 aa
DNA Sequence
>gi|53721039:2770765-2780076 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
CTCACTTCCATTTGATTCGACTATCGGGAATCCAACCAGGATCGTTTTTACCGCTCACCTGGACAACTTC
GCCGGTCCGGTCGTTGACCACAACATAACCACTCTTAGAACCGTACACGGATGCGGAATCATTTCTCGGC
AACCCGTCTGGGGTCTTCCCCGCAGATCGATTGTCCATCGTCGTTCCGACAGGTCCCTCATTGACGACTG
CTTGCACTTCTTGCTGCGTCCATCCACGAGCCTCAAGTTGGCCGCCGATCTTGCCGTCGATAACAACCTT
GCCCACGTTTGTGGCCGATGATGTACCCGCCGCCGCAACTCCACCATTGGCCGTTGGGAGTTGCGCATTC
GCTCCCGAACTCCCCGCTGTCGCCGTTCCCGGCGAGGGCGACGCGCTTGCGCCATTGCCATACGGTTGGG
TTCTTGCCGCATTGCCGGCTGCGCTCAAGTCTCCACTGGCGGTTTTGAGCGCACCGTTTCCAACCGTGGC
CGCATCCGCCGATGTTGTTGTCGCACCAGTTCCGGCTGCCGCTTTGCCTCCGAGACCCAGTGTCGCCAGG
ACAGGTGTCCAGAACTCCGCGTCAGGCCCAATCGATGTTCCAGACTTGTAGGGTTTCTTCAACCCATCGA
GTGAGACATAACCCGGATCGCCGGGCGACGCGAAGGGCCCGCCGTTCGGAAGATTAACGATCACGCCCGC
GACGTTGACCATTCCGTTCCAGACACCGGCCTTGCCATCTGCCGTCATGGCGATGGCTTGAGCAACCTTC
TTCGACAACGATGCAAAGACGTCGTTTGACGTTTGATTGTTCGAATCGTTACCTGCATTATAAAGCTGCA
CATTCGACGCCATCGCTGCGCCCGCACTACCGCCCACCAGTGCGCCACCAACCGTTGCCGCGACGTTCGC
CGCGATGTTGCCGACCAGCGACGAGCCGGTCGTATCACCCACCGACTTACTGATCTTCTCTGCCTGGTTC
GCCAGCAGTGACGACATGCCGGCTCCCGCTGCCCCACCGATCGCCGTAAGCGCGCTGCCCCCGCCGAGCC
CGCCGATCAACGCACCGCCGCCCATCTGCAATTCCGCGCGCGACGCTCCGCCTTCCATCCAGCCCTTGGC
TTCGTTCAACGCCGCCTGTGCGCCCGCCAAATCGCCAGCCTTATAGGCTTTGTCAGCCGCGTCCAATGCT
GCGTCGCGCTTGTGGTCGGCATACAGACCGATCGCCTGCGACACCGTCTGCCCGGCCGCCTGGGCGGCGT
TCATCGTGTCAGCCTGCTGCGACAGCATCTTTTGTACATCAGGCGTCTTCGAAACGGTCCCGTTCAGATT
CGTCGTGTCGCGGTTCAGGTTCGCGACGTCCTGCGTCTGCTCGCCCGGCTTCGTGATATTGATCGTGCCG
GCGCTCACCGCGCTCTTCGTCGTCGCGCTTTGGTCGCCGCTGTCGTTCTGGAACACCATCGGCGTGACGC
CACCCGAACCCGATACCGACGACGGCCCAACTGCCTTGGTGCTTACCCCAACTGACGCGCCAGCGCTAAA
GCCCGCACTGTTCGCGCTGTAGTGCGAGTGGTTCTCGATGTCGCTCGTCGTGAGCGTGCCCGTCGTCAGA
CTGTTCTTCGACGCATCGGCCGTGCTGGCGATATACGCGCCCTTCAGGTCGGTGTTGCCCCTCACGGTCA
CGTCGAACCCGCCCGAGCCGGCCTGGATACCTGCCTGCTCATTCACGCCCGCATAGTTGCCGTCCGCGTG
GCCGTTCTGTGCACTGAAACTAGCCCCGCCGCCGGTCTGGCTGATCGTGAAGCCGCCGCCCGCGCTCGAC
TGATGCGCGGCGCTTACGGTCGTATCCTGGACGCTCGCCACGTTCAGGTTGCCGCCCACGTCGGCCACGA
CCTTGTTCGCGTTCACGTTCGCGCCGATCACGTTCGTGTCGCCGCCGCTGACAATGGTCGCGGTCTGGCT
GGCGTTGATGTGCGTGTTGTTCTGGATCGCCGCGTCCGAATTCCCGTCGCCGTGCGCGCGCTGCATCGAT
GCGGAGACGCCGATGCCGTTCGTGCCGATCGACACGCCGACGCTCGACCCCGACGACGAGTTCGAACTCT
GCGTCTTGTCCGTATCGGTCGTGTTGACGAGATTGACCTGGTTGTTCGCGACCAACGCCACGTTGGCCGC
GTTCACGTTCGAGCCCGCGATCGTGATGTTGCCGTCCTTCGGCGTACCGTTGCCCGTCGCGATCAGCTTC
GCATTGCCGCCCGCGTTAATGCTGGAGCCGCGCTGAATCGTCTGATCCTCCGACGACTGCATCGAACTAT
GGCTCGAACCGACACTGACCTGCACGCCGATGCTCGGGGCCTGCGGCCCCTTCGCGCCGTCCAGCAGGGC
CTTGGCCCCCAAACCGCCGAATGCCACATCACCGGCCGCCGCGATGCTATGCAGTGCCGATGCGCGGCCG
TTGCTATCCTTCGCCGATTCGCGCGCGGCCTGCGTCTCGCTGATCGCATTGTTGATCGCATCGCCCACCG
AGCCCGACAGGCCGACCGTCAGCCCGCTCTTGCTCGTCTGCTGCTGTTGCGCTTGACGCGTGGTGTCGGT
GGCCGAATCGACGACGATGTTCGCCGCCGTCCCGGTCACATCCTTGCCCGCGACCAGATCGCTGCCTTTC
ACGTGCAGCGTATTACCCGCATTGACGGTCAGATTGCCGTCGACCGAGCCGACCGTGCTGGCGTTGTTCG
TGACGCTCGAGGATTGATTCTGCTGCGCGAGCTTGCTGTTGCCGACCGAGAAAGACAGACCGCCGCCCGA
CATCAAACCCGAGTGCTGTTCCTGATAGGTGGTCGACGATTGGCTGGTGTCCTGCGACGTCGTTATGTTC
ACGTCGTGCGCCGCATTCAGCGCCACATCGTGCGTACCGACGACCGTACTACCTTGAACATTGATGTCCT
TGCCGCTGCCGATCGACACGCCGTCCGCCGAAATCAGGCTGCCGTTCGCGACGGTGCTGGTCGCGTCCTG
ACTGCTGGCGATCTTCGTGCCGCTCACGACGCCACTGCGGCTATGCGTCTCGCGCGAGTTGTACACGTGC
GTTTCGGTCGCGGCCCCGACGTTCACGTCGCCGGCCGCCAGCAGGTTCGCATCGCCTTTCTTCAGGTCGA
TCGTGCTGCCGATGACATTGATGTCCTTGCCCGACACCACATTCAGCGTATCGCCGCCCTTGACGGTCGT
GCCTGTCAGCGCCTGGTCCGCTCCATGCCGGGTTTCCGCATAGCTGCGATTCCCCTGGTCGCCCGAGCTG
TTGGCGTTGATGGTCGACGTGGTGCTCGCCGCACCGAAGGTCACGTTGCCCTTGGCCGCGACCGTGCCGC
CTTGGCCGAAGTCGAGCCGCGCACCTTGCGCCGTCAAGTCACCGCCCACACCGATGGCCGACTTGCCGCC
GACGTTCACGGTGCTGCCGGTCGCGCTGTTGAGGTCCGTATCCGACACGCCGTTCGCACGCTGCACGACC
TTGTGTTCGCCGGTCTGCTGCACGCCTAGATTCCAGTTCCCGCCGATATTGGCGTTCAGGTTCCCGCCGA
CGCTCAGGTTGCCCGCGTTCTGCTGGAAGTCGCCGCCGGTCTTGATCGACGCGTCGCCAGCCACGTTCAG
GTTTGCAGCCGGCCCGAGCGTCGTCTTGTCGCTCGTCGCGCCGTCGCGGCTGACCTGGTGCGTCGTCTGC
GTCGCCGTATCCAGAATCAGCTTGTTGCCCGCGTTCAGGTCGAGGCTACCGGCCTTCACATTGGCCGAGG
TGAGATCCACGTTGCCTGTCGTGTCGAGCGACGTCAAGCCGCCGCTTTGCAGCGCACCGAACGCGTTGTC
GATCTGCTTGCCCTGAAGCGCAAGCGTCGTGTCCGCCTTCACGGTCCCGCTGTTCGTGAAGACCTGCGTG
TTCTTCAAATCGATATTGCCAGCCGTGATCAGCGGCCCGTTCGCGTTCTGCTGATCGGCCTTCGCCAGAT
ACACGACCGGCACCAATACCTGCTGGCCGCCGACCGTCTCGGTCTGCATGATGATCACGTTGGTCGTGAG
CGCGGCCACCTGCTGCGCCGACAGGCTCATGCCGAGCGGCAGGTTCAGCGACTTCGACAATTCGGCGCCC
GCGAGCATCAGCGACTGATACATGCCCTGGAGGTCCGTATACGGCCCCAATACCGCCTTGCCCGTCAGTT
GCGTGACCTGGTTGCGCACGAGCTGCTGCTCGTAGAACCCGTCACCGAGGCGCTTTTCTGTCGTCAGCGG
GTTGACGCCGATCTGGTTCAGGTAATAGTCGCTCGACAGGAAATTGTTCATCCGCGTGAACGCGGGGTTC
GTCTCGATCAGGTACGTCGGGTTCGGTGCCGAGTTCGGTCGGTACAGGCCGCCTTGCGGAATCGTCAGGT
TGCTCAACACGTTCACGGCCGTCGCGCTCGCGATCACCGGATCGACCCAGGTGGGCGTGCCGCCCTTGAT
CGCGGCGGCTCCCGACTGCGTACCGCTCGCGTTGCCGCTGACCGTGCCGATCGTCAGCCCCGGCACGGCC
TGGCCGGGCAGCAGGCCGAGCGACGGAATGGTCGCATTGGCCGCCGTGTTGTTCACGCTCACGCCGTTGC
CCGAGATCGTGCCGTTCGCGCCCCACGTCGAGCGATAGTCGGGCAAGCTGTATTGCCGCACATCGGCCGG
CGCGGCCTGCGTATAGCCGCCTGGTCCGCCGACGAACGGCTTGTCGCCGAACGGCAAGGTCCAGTTGTGT
TCCGAGTTGTCGTAGTTGTTGTAGTGGTAGTAGCCGGAATACACGACCGTCACGCCCGGCGCCTGCTGAC
CCGTCGCGCCCCAGCCGTCCATGTCGAGGCTCGCGGGCTGCTTGATGTTGCCGGCCGCCGTCACACTGCT
CCAGTAGTTCTGGAATGTCTTGACCGTCGACGCGTCGAGATCGCCGCCCGATGCGATCTGCGCGCCCGGG
CTCAGCTTCGTCACGGTGTTGGCGGTCGCCTTGCCCTCATAGGTCGTGTATTGATACCCGCTGTTCCATT
GGCCACCGTTCGGTGGAACGGTAAAGACCCCGCCCGGCTGCAATTTGAGCGCGGCAATGATCGGCGCGGG
ATCGTAATCGGGGTAGTTCGGATCGTGGAACAGGTTGATCCAGTGCACGTCCTGACCACTACAGGCCGCA
ATGTAGTAGGCGGCGCACCCGGACATGCTGATGCCGAGCTGTTGCAGCAATGCCGGATCGACCTGACTCG
TGTTGCCCGAGGTCTGCATCACGCGCCGCGTGTTCGTGACCTTGTCGGCGTGCAGTTCCATCGAAGCGCC
CGATTGGATCGCCGCCGACGAATTGTTGATCAGCGCTGCGTTCGTATAGTTGCCGTTCGCGTCCTTGCCG
CCCGCCAAAGCCACTTTGCCAAGCCCGAAGATCGTCGTGGTCGGCATCGAATCGCCCAACGTCGTGTCGT
CGCGGTTCTCGATGTCGTGCGCGACGATTTCCAGCAGGCCCGACGTGTCCGATGCGCCGATCAGCGCGAC
CGGGCCGAGGTTCGACACCGTGCCGCTCGCCTGGATGGCGACGCTGCCGCCGACCATCGCGCCATAGTTC
GTCAGGTCGCCCGAATGCGTACTGAGCAGGCTGCCTGCCGTCATCGCGCCCGTGTTGACGATGTTGCCGG
CGTTGACCGTCAGGTTATGGACCGATTGCAGGTTCGCGCTGTTGGCGAACGTGCCCGGCAAGGTAAACGT
CAGGTCGCGACCAATGTTGAACTGCGTTTGCGGCGTCGTCGTGAAGTCGCCTTGCAGATTAATCGCCGCG
TCACGCGCCGCGCTGTATGCGCCGCCGCCGAGCAGCGTGGAAGCCGCTACCGACAGGTCGCGCGTCGAGG
TGATCGACCCGTTGGTATTCGTCACCGCGCCCGACATCGCGACGTTCACGTCGCCCGTGGCGTTCGCGAC
GTTGCCGACCTGTCCTCCGGAGTTGTCCAGCGTAGCGCCTTGAATCAGCAGGTTCGCGCCCATCAACTGG
CCGCCCTGCGTGTTCGAGATCGAGGCCGCACCGATTGTCACGTCGCCCTGGCCGGTCATCTGCCCCATGC
CGTCGACGCCGCCCGCGTGGCTGTTCACGATCTGACTGCCGCCTTGCACGGTCATCTTGCCCGTGCCGAA
GTCGTGCACCGCGCCATCGGTGTTGTCGATCGAAGCGGCCTGAATCGACAGCGTGCTCGTGTCGCCGGGC
GTGCCCGCCTCGATGTGCCCTTGGTGGTTCGACAGTGCCCCGTTGCCGATGATCGACAGCGCCGCGTTCG
AGCGCATCAGACCCTGAGTATTGTTCATCGCCCCGGCGATCGTGGCCGACAGACCCAGTTTGGCGGCGAT
GACCCCACTACCATTGTCCAGACTGCCGGCCTTCACGATGGCCTGTCCGTTGGTGCCGATCGTGCCGCCA
GTATTTTGCAAGGCTCCCGCGCCGTTGCCGGGCGTGAGCGTCAGCGTGCCGGTCCCACCGTGCGTGATGG
TGCCTTTCGAGTTGTCCAGAACGGCCGGCGCGAGCGTCAGGTCCGTGCTGTTCGTCTGGATGACGCCGCC
GTTCGAATTGTCGAGCGTGCCAGAGACGGCGAGTGTGGTCGGGCCGCTCTGCCATTGCGAGATGTGGCCG
CCCTGGTTTTTCAGGTTCGCGGCCGTCAACGCAAGCTGATTGGCTTCGAAGTCGCCGTTCTGGCTGTTGT
CGAGCAAGCCAGCAACGGTTGCCGTCAAAGTGGGGGAGACGATCTTGCCGTTCAGATTCGAGAGCGAGGC
GCTATGAATCGTCGTCGCTGCCGTCTTTGAGCCGAGTTCACCGCCGTCGTTGACCAGTGCTCCACCTGCG
GTCACGTCGACGTTGGCGTTCGAGGTGAGCTTGCCGCCCAGATTCGTAATCGAGTCGGCGGCGTTGACGC
TCAGGCCCGTTTGGCCGGACGCCGAACCGGCCGAGTTGTCGATCGTCTTGCCTTGCAGGACGGTTCGGCC
GTTGCTGGCGATGGCGCCCGCTTTGTTGCTGACCGTGCCCGAACCGTTGCCAACCATCAGCGTGCCCGGG
CCAACGTGCGTGATCGTGCCGCCGTTGTCGTTGATCAGGGTAGTGGACGTGAGCGACAGATCCGTGCTGC
GCGTCTGGATCAGGCCGTTGTTCGAGTTGTCGAGGGTGTCGGTAATCGCGACCGTCATCGGGCCGGTGCC
GGTCTGCGTGACCGTCCCGCCGTGGTTCAGCAACGTCGTGCCGTTCAGCGAGACCGTCGCCGCATTGACC
GTGCCCTGGGAGTTGTCCAGCGTCGCGCCGTTCAACACGGCGCTTTGACCCTCAACCCGGCCGCCGGCAT
TCGAAAGATGATTGCCGGCGTCGACGGTGGTAGTCTGTCCGGCGTGCAGCGCGCCATTACCGTTGTCGAC
GCTCTGGCCGATCACGTGCAGGTTCGCGTCGGCCGACATCGAGCCGCTGTTCGTGACCGTGTTCCCCTGT
ACGGTCACGTCGCCCTTGCCGCCGATGACGCCGCCCGGATCGCCACTCACGTTCGCGCCGGCCGCGTTCG
TGAGTGCGCCGGTTGCCGTCACCGACAGGCCGTCTGCGTTCAGGGAAATCAGCCGGCCTGCCGAATTGTC
GATCGATGCGCCAGCAATCGTTTGCTTGCCTGCGCTCTGAATCAGCCCGGCATTGTTCTGGATCGCACTC
CCGCGAACGTCGGCCGTGCTTTGGGAACTCAGCATGCCGTTTTGGTTCGACACGGTGCCGGCCATCTGCA
CCGACAGCGGGCCTTGCGAATTGGCACGGCCGCCCTGGTTCGACAGGCTGCCGCCGCCAAGCGTCATGCC
CGCGCCGCTGGACAGATTGCCCCGGTCGTTGATGACCGTGCCGCTCGCCTGCGCGTTCACGGCGCCCTTG
GCGCTGACAGTCGAGCCGGCCAGATTCACATCGCCCGCCGTCGCGCTCAGCGCGAGGTTGCCGTTGGCGG
CCGTTGCGCTGTTCGACAGATTGATGCCGCTACCGGTGAAGGTCGCGTTGCCAGCCGCGCTGTTGGTCCC
CGTCGCGGTCAACTGGCCGCTGCTCGTGACGTTCAGATCGCCGCTCGTGCTGACCGTGCTGTCGACGTTG
ATGCCTGCGCCGAGCGTGCCCGTCGAGTTGAGGCTGCCGACGTTAGCGGTCAGGTTTTGTTGGGCGGTCA
GCGCGCCGCTGTTGGTCAGGTCCGTGCCCGTGGTGATCGTGACCGATTGCTTGCCATACGTGACGCCGCT
GTTCTGAATGCCACCCGAGGCTGACAGCGACATATTGCCGGCCGCATTGGTGTGGCCCGACAGGACGAGG
CGGCCGTTCGCTTGCAGCGTCAGGTCGCCGGCTTGCGCGGCGATGTCGCCGGCATTGGCAACACCAACGC
CATTCTCTGACGAGACGAGAAAGACCCTATTCGCATACATTCCGCCAAGCTGGCTCACATCGATCGCGAT
GGTGGGCGCGGGACCGTTGGCGGCGATCGGCGTGGCGTTCAGCGTGTTGTAGTCGACTTGGTTCGATCCA
GCCACCACGTTCAGGGTCTTCGCGTAAGCCTTAGCGTTAATTTGTACGGCGCGGGCCAACAAATCCACCT
GATCGACATTGGCCGTATCGAGCCCCGCGCCGACCACCGAAATCAGGCCTTGGTTGACGTTGAAACCCGT
GAGCGAGCCGTCGGGCCCGAAGTTCGGATTGCCGGTTGTCAGCGTGGCTCGGCTCGTATTGAGGAAGCCG
CCACCATCCACGACCAAGCCAGCCTGATTCGCGATCACGAGCTGGGCGGCCGCGCCCCCGATTTCGACTT
TGCCGCGGATAAAACTCGGATTGTTGCTGTTGACCTGGTTGACGATCAGACGTGCCGCGTCGCCGGCCTG
GAAATTCGGGTTGCCGCCGATAATGCCGCCCAGTTGAGTCTGGACGTTAATCGGGGAGTTGTTGAGAATA
ATCCCGGGTTTGGGTACGTCGAACTGGTTGTACGTGTTCATCGACACGCCCGACGCGCCGGGGCGGTTGA
TGTTCACCTGTTGAAGTCCATTCTGTGTCTGGATCACGGACGGGGCGTGTGCGCCGCCTGCGACAACCTG
GGCATTGACCCATATCGGCACCACGCCGGCCGCAACCAGTACCGCGAGTGCAACATGGCGCAACGCAAAC
GGCGAGAGCGACAGCCAAGCAGGGACGACGCCCGCGCTCGCGTCGCGGCTGCCGCTACCGTGGGACGCAC
GGCCATTCTCTTGCACCACCATGAGTGCGCCGCGCGCGCGATTGAAGACAACCCGATAGCGATTCTTGTT
CA

Protein Sequence
>gi|53723070|ref|YP_112055.1| cell surface protein [Burkholderia pseudomallei K96243]
MNKNRYRVVFNRARGALMVVQENGRASHGSGSRDASAGVVPAWLSLSPFALRHVALAVLVAAGVVPIWVN
AQVVAGGAHAPSVIQTQNGLQQVNINRPGASGVSMNTYNQFDVPKPGIILNNSPINVQTQLGGIIGGNPN
FQAGDAARLIVNQVNSNNPSFIRGKVEIGGAAAQLVIANQAGLVVDGGGFLNTSRATLTTGNPNFGPDGS
LTGFNVNQGLISVVGAGLDTANVDQVDLLARAVQINAKAYAKTLNVVAGSNQVDYNTLNATPIAANGPAP
TIAIDVSQLGGMYANRVFLVSSENGVGVANAGDIAAQAGDLTLQANGRLVLSGHTNAAGNMSLSASGGIQ
NSGVTYGKQSVTITTGTDLTNSGALTAQQNLTANVGSLNSTGTLGAGINVDSTVSTSGDLNVTSSGQLTA
TGTNSAAGNATFTGSGINLSNSATAANGNLALSATAGDVNLAGSTVSAKGAVNAQASGTVINDRGNLSSG
AGMTLGGGSLSNQGGRANSQGPLSVQMAGTVSNQNGMLSSQSTADVRGSAIQNNAGLIQSAGKQTIAGAS
IDNSAGRLISLNADGLSVTATGALTNAAGANVSGDPGGVIGGKGDVTVQGNTVTNSGSMSADANLHVIGQ
SVDNGNGALHAGQTTTVDAGNHLSNAGGRVEGQSAVLNGATLDNSQGTVNAATVSLNGTTLLNHGGTVTQ
TGTGPMTVAITDTLDNSNNGLIQTRSTDLSLTSTTLINDNGGTITHVGPGTLMVGNGSGTVSNKAGAIAS
NGRTVLQGKTIDNSAGSASGQTGLSVNAADSITNLGGKLTSNANVDVTAGGALVNDGGELGSKTAATTIH
SASLSNLNGKIVSPTLTATVAGLLDNSQNGDFEANQLALTAANLKNQGGHISQWQSGPTTLAVSGTLDNS
NGGVIQTNSTDLTLAPAVLDNSKGTITHGGTGTLTLTPGNGAGALQNTGGTIGTNGQAIVKAGSLDNGSG
VIAAKLGLSATIAGAMNNTQGLMRSNAALSIIGNGALSNHQGHIEAGTPGDTSTLSIQAASIDNTDGAVH
DFGTGKMTVQGGSQIVNSHAGGVDGMGQMTGQGDVTIGAASISNTQGGQLMGANLLIQGATLDNSGGQVG
NVANATGDVNVAMSGAVTNTNGSITSTRDLSVAASTLLGGGAYSAARDAAINLQGDFTTTPQTQFNIGRD
LTFTLPGTFANSANLQSVHNLTVNAGNIVNTGAMTAGSLLSTHSGDLTNYGAMVGGSVAIQASGTVSNLG
PVALIGASDTSGLLEIVAHDIENRDDTTLGDSMPTTTIFGLGKVALAGGKDANGNYTNAALINNSSAAIQ
SGASMELHADKVTNTRRVMQTSGNTSQVDPALLQQLGISMSGCAAYYIAACSGQDVHWINLFHDPNYPDY
DPAPIIAALKLQPGGVFTVPPNGGQWNSGYQYTTYEGKATANTVTKLSPGAQIASGGDLDASTVKTFQNY
WSSVTAAGNIKQPASLDMDGWGATGQQAPGVTVVYSGYYHYNNYDNSEHNWTLPFGDKPFVGGPGGYTQA
APADVRQYSLPDYRSTWGANGTISGNGVSVNNTAANATIPSLGLLPGQAVPGLTIGTVSGNASGTQSGAA
AIKGGTPTWVDPVIASATAVNVLSNLTIPQGGLYRPNSAPNPTYLIETNPAFTRMNNFLSSDYYLNQIGV
NPLTTEKRLGDGFYEQQLVRNQVTQLTGKAVLGPYTDLQGMYQSLMLAGAELSKSLNLPLGMSLSAQQVA
ALTTNVIIMQTETVGGQQVLVPVVYLAKADQQNANGPLITAGNIDLKNTQVFTNSGTVKADTTLALQGKQ
IDNAFGALQSGGLTSLDTTGNVDLTSANVKAGSLDLNAGNKLILDTATQTTHQVSRDGATSDKTTLGPAA
NLNVAGDASIKTGGDFQQNAGNLSVGGNLNANIGGNWNLGVQQTGEHKVVQRANGVSDTDLNSATGSTVN
VGGKSAIGVGGDLTAQGARLDFGQGGTVAAKGNVTFGAASTTSTINANSSGDQGNRSYAETRHGADQALT
GTTVKGGDTLNVVSGKDINVIGSTIDLKKGDANLLAAGDVNVGAATETHVYNSRETHSRSGVVSGTKIAS
SQDATSTVANGSLISADGVSIGSGKDINVQGSTVVGTHDVALNAAHDVNITTSQDTSQSSTTYQEQHSGL
MSGGGLSFSVGNSKLAQQNQSSSVTNNASTVGSVDGNLTVNAGNTLHVKGSDLVAGKDVTGTAANIVVDS
ATDTTRQAQQQQTSKSGLTVGLSGSVGDAINNAISETQAARESAKDSNGRASALHSIAAAGDVAFGGLGA
KALLDGAKGPQAPSIGVQVSVGSSHSSMQSSEDQTIQRGSSINAGGNAKLIATGNGTPKDGNITIAGSNV
NAANVALVANNQVNLVNTTDTDKTQSSNSSSGSSVGVSIGTNGIGVSASMQRAHGDGNSDAAIQNNTHIN
ASQTATIVSGGDTNVIGANVNANKVVADVGGNLNVASVQDTTVSAAHQSSAGGGFTISQTGGGASFSAQN
GHADGNYAGVNEQAGIQAGSGGFDVTVRGNTDLKGAYIASTADASKNSLTTGTLTTSDIENHSHYSANSA
GFSAGASVGVSTKAVGPSSVSGSGGVTPMVFQNDSGDQSATTKSAVSAGTINITKPGEQTQDVANLNRDT
TNLNGTVSKTPDVQKMLSQQADTMNAAQAAGQTVSQAIGLYADHKRDAALDAADKAYKAGDLAGAQAALN
EAKGWMEGGASRAELQMGGGALIGGLGGGSALTAIGGAAGAGMSSLLANQAEKISKSVGDTTGSSLVGNI
AANVAATVGGALVGGSAGAAMASNVQLYNAGNDSNNQTSNDVFASLSKKVAQAIAMTADGKAGVWNGMVN
VAGVIVNLPNGGPFASPGDPGYVSLDGLKKPYKSGTSIGPDAEFWTPVLATLGLGGKAAAGTGATTTSAD
AATVGNGALKTASGDLSAAGNAARTQPYGNGASASPSPGTATAGSSGANAQLPTANGGVAAAGTSSATNV
GKVVIDGKIGGQLEARGWTQQEVQAVVNEGPVGTTMDNRSAGKTPDGLPRNDSASVYGSKSGYVVVNDRT
GEVVQVSGKNDPGWIPDSRIKWK

Molecule Role Virulence factor
Molecule Role Annotation MUTATION: BPSS2053 mutant had reduced microbial adherence to human epithelial cells (Sim et al., 2008).
References
Sim et al., 2008: Sim SH, Yu Y, Lin CH, Karuturi RK, Wuthiekanun V, Tuanyok A, Chua HH, Ong C, Paramalingam SS, Tan G, Tang L, Lau G, Ooi EE, Woods D, Feil E, Peacock SJ, Tan P. The core and accessory genomes of Burkholderia pseudomallei: implications for human melioidosis. PLoS pathogens. 2008; 4(10); e1000178. [PubMed: 18927621].