Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

RVA_s10gp1

Victor ID 3430
Gene Name RVA_s10gp1
Sequence Strain (Species/Organism) Rotavirus
NCBI Gene ID 7011361
NCBI Protein GI 210136688
Locus Tag RVA_s10gp1
Protein Accession YP_002302223.1
Other Database IDs UniProtKB-ID: A2T3P6_9REOV
UniRef100: UniRef100_A2T3Q0
UniRef90: UniRef90_Q6QT02
UniRef50: UniRef50_P89061
UniParc: UPI00000EEBC1
EMBL: DQ838621
EMBL: DQ838622
EMBL: DQ838623
EMBL: DQ838624
EMBL-CDS: ABG75795.1
EMBL-CDS: ABG75796.1
EMBL-CDS: ABG75797.1
EMBL-CDS: ABG75798.1
RefSeq_NT: NC_011504.1
Taxonomy ID 28875
Segment No 10
Gene Starting Position 0
Gene Ending Position 527
Gene Strand (Orientation) +
Protein Name NSP4
DNA Sequence
>gi|210136687:1-527 Rotavirus A segment 10, complete genome
ATGGAAAAGCTTACCGACCTCAATTATACATTGAGTGTAATCACTCTAATGAACAATACATTGCACACAA
TACTTGAGGATCCAGGAATGGCGTATTTTCCTTATATAGCATCTGTCTTAACAGTTTTGTTTGCGCTACA
TAAAGCATCCATTCCAACAATGAAAATTGCATTGAAAACGTCAAAATGTTCATATAAAGTGGTGAAATAT
TGTATTGTAACAATTTTTAATACGTTGTTAAAATTGGCAGGTTATAAAGAGCAGATAACTACTAAAGATG
AGATAGAAAAGCAAATGGACAGAGTAGTCAAAGAAATGAGACGCCAGCTAGAAATGATTGACAAATTGAC
TACACGTGAAATTGAACAAGTAGAGTTGCTTAAACGCATTTACGATAAATTGACGGTGCAAACGACAGGC
GAAATAGATATGACAAAAGAGATCAATCAAAAAAACGTGAGAACGCTAGAAGAATGGGAAAGTGGAAAAA
ATCCTTATGAACCAAGAGAAGTGACTGCAGCAATGTA
Protein Sequence
>gi|210136688|ref|YP_002302223.1| NSP4 [Rotavirus A] MEKLTDLNYTLSVITLMNNTLHTILEDPGMAYFPYIASVLTVLFALHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVQTTGEIDMTKEINQKNVRTLEEWESGKNPYEPREVTAAM
Molecule Role Virulence factor
Molecule Role Annotation MUTATION: NSP4 mutants that fail to bind or signal through integrin alpha2 were attenuated in diarrhea induction in neonatal mice (Seo et al., 2008).
References
Seo et al., 2008: Seo NS, Zeng CQ, Hyser JM, Utama B, Crawford SE, Kim KJ, Höök M, Estes MK. Integrins alpha1beta1 and alpha2beta1 are receptors for the rotavirus enterotoxin. Proceedings of the National Academy of Sciences of the United States of America. 2008; 105(26); 8811-8818. [PubMed: 18587047].