Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

FTL_0846

Victor ID 404
Gene Name FTL_0846
Sequence Strain (Species/Organism) Francisella tularensis
NCBI Gene ID 3950835
NCBI Protein GI 89256206
Locus Tag FTL_0846
Protein Accession YP_513568.1
Taxonomy ID 119857
Gene Starting Position 827532
Gene Ending Position 828104
Gene Strand (Orientation) +
Protein Name isochorismatase hydrolase family protein
DNA Sequence
>gi|89255449:827532-828104 Francisella tularensis subsp. holarctica LVS chromosome, complete genome
AATGAAAAATACTTTTGTAATAGTTGCTGATTTTATAAATGAAATCGTGGATGAAAAGGGTGCTTTCGGT
GCTCATAATGCACAAAGAATTAAAGATGATGAAACCATGCAAAAAGCTAATAAGTTAATAGCTTGGGCAA
GAGATAACAGTATTCAGATTGCTCATGTAAAAGTAGGTTTTACTAAGGAGTATAAAGAGTGCTCCAAAGT
ATCTCCGATGTTTAAAAAAGCTCCGGAGTATGGTGTATTACAGTTGGGTACTTGGGCAACAGAATTTCAT
CCTCAAATGGATGTTCAAGAGCATGATATTATCATCACAAAGCATCGCGTGAGTGCTTTATATGGTACAG
ATCTAGAGCTTATATTACGTGCAAATAGTATTGAGCATGTAATTATCTGTGGGGTATCAACTAGTTATGT
AGTAGAGTCTACAGTCCGTGAGTTGCATGATCGTGATTTTAAGGTTACTGTAATAGCAGATGCATGTAAT
GCCGCTAGTCAACAAGCTCATGAAGCTAGCTTAACAAACTTAAGTAGAATTGCTGATATTGTAGATATTG
ATGATTTTATTTA
Protein Sequence
>gi|89256206|ref|YP_513568.1| isochorismatase hydrolase family protein [Francisella tularensis subsp. holarctica LVS] MKNTFVIVADFINEIVDEKGAFGAHNAQRIKDDETMQKANKLIAWARDNSIQIAHVKVGFTKEYKECSKVSPMFKKAPEYGVLQLGTWATEFHPQMDVQEHDIIITKHRVSALYGTDLELILRANSIEHVIICGVSTSYVVESTVRELHDRDFKVTVIADACNAASQQAHEASLTNLSRIADIVDIDDFI
Molecule Role Virulence factor
Molecule Role Annotation MUTATION: a FTL_0846 mutant was attenuated for infection in a mouse lung (Su et al., 2007)
COG COG1335Q, under Q: Secondary metabolites biosynthesis, transport and catabolism
References
Su et al., 2007: Su J, Yang J, Zhao D, Kawula TH, Banas JA, Zhang JR. Genome-wide identification of Francisella tularensis virulence determinants. Infection and immunity. 2007; 75(6); 3089-3101. [PubMed: 17420240].