Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

lpa_03874

Victor ID 4188
Gene Name lpa_03874
Sequence Strain (Species/Organism) Legionella pneumophila 2300/99 Alcoy
NCBI Gene ID 9130593
NCBI Protein GI 296108291
Locus Tag lpa_03874
Genbank Accession CP001828
Protein Accession YP_003619992
Other Database IDs UniProtKB-ID: D5T9R9_LEGP2
UniRef100: UniRef100_A5IAT0
UniRef90: UniRef90_Q5ZS73
UniRef50: UniRef50_Q5ZS73
UniParc: UPI000044523A
EMBL: CP001828
EMBL-CDS: ADG26040.1
RefSeq_NT: NC_014125.1
GenomeReviews: CP001828_GR
KEGG: lpa:lpa_03874
Taxonomy ID 423212
Gene Starting Position 3104576
Gene Ending Position 3105235
Gene Strand (Orientation) -
Protein Name Legionella transmission activator LetA
Protein pI 5.16
Protein Weight 22879.82
Protein Length 219
Protein Note COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription]
DNA Sequence
>gi|296105497:3104576-3105235 Legionella pneumophila 2300/99 Alcoy chromosome, complete genome
TCTAATCATCTTGTGACAAATCATTGGGGTGTTCAATAATGCGGTGCTTCATAGCCAAATAAGTAAGCTC
CACATCATTTTTAATCCCCAATTTTTCAAACATCCTATATCGATAACCATTGATGGTTTTACTACTTAAA
AATAATCTATCAGCAATGTCTTGTACATTCATGCCGCTCGTAATCATCAACATGACTTGCATTTCTCTTT
CAGACAATAAATCAAAGGGGGAATCTTGAGGCTCCTGAAGACTATTAATTGCCATTTTTTGTGCAATCTC
GGCACTAAGATATTTCTCACCTTTAGCCACTTTACGAATTGCAGCAGCCATTTCTTCAGCCCCTGATTCT
TTAGTAAGGTATCCCATAGCACCTAATTGCAATACTCGAGTAGGGAGAGGATCTGAGCAAATAGCTGTAA
CGGCTATGACTTTAATATTTGGGTTTGTTTTTTTTAAGCGACGCGTCACTTCCCACCCATCTATCCCAGG
CATTTTCATGTCTAATAATACGACATCAGGGGAGTGGGTTTTCACATAAGCTAAAGCCTGCTCCCCACTT
TCAGCATCTGCAACCACATCAACATCCGACATATCTTCAAGCAATCGTCGAATGCCCATTCTAACCAATG
CATGGTCATCAACAATTAATACTTTAATCA

Protein Sequence
>gi|296108291|ref|YP_003619992.1| Legionella transmission activator LetA [Legionella pneumophila 2300/99 Alcoy]
MIKVLIVDDHALVRMGIRRLLEDMSDVDVVADAESGEQALAYVKTHSPDVVLLDMKMPGIDGWEVTRRLK
KTNPNIKVIAVTAICSDPLPTRVLQLGAMGYLTKESGAEEMAAAIRKVAKGEKYLSAEIAQKMAINSLQE
PQDSPFDLLSEREMQVMLMITSGMNVQDIADRLFLSSKTINGYRYRMFEKLGIKNDVELTYLAMKHRIIE
HPNDLSQDD

Molecule Role Virulence factor
Molecule Role Annotation MUTATION: letA mutant is non-motile and is attenuated for infecting murine macrophages (Hammer et al., 2002).
COG COG2197TK, under T: Signal transduction mechanisms; K: Transcription
References
Hammer et al., 2002: Hammer BK, Tateda ES, Swanson MS. A two-component regulator induces the transmission phenotype of stationary-phase Legionella pneumophila. Molecular microbiology. 2002; 44(1); 107-118. [PubMed: 11967072].