Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

pilI from Pseudomonas aeruginosa PAO1

Victor ID 4216
Gene Name pilI from Pseudomonas aeruginosa PAO1
Sequence Strain (Species/Organism) Pseudomonas aeruginosa PAO1
NCBI Gene ID 878186
NCBI Protein GI 15595607
Locus Tag PA0410
Protein Accession NP_249101.1
Other Database IDs UniProtKB-ID: PILI_PSEAE
UniRef100: UniRef100_P43502
UniRef90: UniRef90_P43502
UniRef50: UniRef50_P43502
UniParc: UPI0000131ACB
EMBL: L22036
EMBL: AE004091
EMBL-CDS: AAA25951.1
EMBL-CDS: AAG03799.1
RefSeq_NT: NC_002516.2
GenomeReviews: AE004091_GR
KEGG: pae:PA0410
PseudoCAP: PA0410
HOGENOM: HBG701045
OMA: DLCGFFG
ProtClustDB: CLSK865839
BioCyc: PAER208964:PA0410-MONOMER
Taxonomy ID 208964
Gene Starting Position 450508
Gene Ending Position 451044
Gene Strand (Orientation) +
Protein Name twitching motility protein PilI
DNA Sequence
>gi|110645304:450508-451044 Pseudomonas aeruginosa PAO1 chromosome, complete genome
CATGTCGGACGTTCAGACCCCCTTCCAGCTCCTCGTCGACATCGATCAGCGCTGCCGACGCCTGGCCGCC
GGCCTGCCGGCCCAGCAGGAGGCGGTGCAGAGCTGGAGCGGGATCGGCTTCCGCATGGGCGGGCGGTTCT
TCGTCGCCCCCATGGGGGAGGTCGGCGAAGTCCTGCACGAACCGCGCTACACCCAGCTGCCGGGCGTGAA
GACCTGGGTCAAGGGGGTGGCCAACGTACGTGGCCGCCTGCTGCCGATCATGGACCTCTGCGGTTTCCTC
GGCACCGAACTGTCGCCCTTGCGCAAGCAGCGGCGGGTGCTGGTGGTGGAGCACCTGGACGTGTTCGCCG
GCCTCATCGTCGATGAGGTGTTCGGCATGCAGCACTTCCCGGTGGACACCTTCAGCGAACAGCTGCCGCC
ACTAGAAGCGGCACTGCAACCCTTCATTCATGGCGTCTTCCATCGAGAGCAGCCGTGGCTGGTGTTCAGC
CCGCATGCGCTGGCGCAACACCAGGGCTTCCTCGACGTCGCCGTATA
Protein Sequence
>gi|15595607|ref|NP_249101.1| twitching motility protein PilI [Pseudomonas aeruginosa PAO1] MSDVQTPFQLLVDIDQRCRRLAAGLPAQQEAVQSWSGIGFRMGGRFFVAPMGEVGEVLHEPRYTQLPGVKTWVKGVANVRGRLLPIMDLCGFLGTELSPLRKQRRVLVVEHLDVFAGLIVDEVFGMQHFPVDTFSEQLPPLEAALQPFIHGVFHREQPWLVFSPHALAQHQGFLDVAV
Molecule Role Virulence factor
Molecule Role Annotation MUTATION: pilI mutant is attenuated in rats (Potvin et al., 2003).
COG COG0835NT, under N: Cell motility; T: Signal transduction mechanisms
References
Potvin et al., 2003: Potvin E, Lehoux DE, Kukavica-Ibrulj I, Richard KL, Sanschagrin F, Lau GW, Levesque RC. In vivo functional genomics of Pseudomonas aeruginosa for high-throughput screening of new virulence factors and antibacterial targets. Environmental microbiology. 2003; 5(12); 1294-1308. [PubMed: 14641575].