Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

mucA

Victor ID 4227
Gene Name mucA
Sequence Strain (Species/Organism) Pseudomonas aeruginosa PAO1
NCBI Gene ID 879357
NCBI Protein GI 15595960
Locus Tag PA0763
Protein Accession NP_249454.1
Other Database IDs UniProtKB-ID: MUCA_PSEAE
UniRef100: UniRef100_P38107
UniRef90: UniRef90_P38107
UniRef50: UniRef50_P38107
UniParc: UPI000012F8D3
EMBL: L14760
EMBL: U49151
EMBL: AE004091
EMBL-CDS: AAA87629.1
EMBL-CDS: AAC43715.1
EMBL-CDS: AAG04152.1
RefSeq_NT: NC_002516.2
GenomeReviews: AE004091_GR
KEGG: pae:PA0763
PseudoCAP: PA0763
HOGENOM: HBG401528
OMA: VRLYNQD
ProtClustDB: CLSK866099
BioCyc: PAER208964:PA0763-MONOMER
Taxonomy ID 208964
Gene Starting Position 831913
Gene Ending Position 832497
Gene Strand (Orientation) +
Protein Name anti-sigma factor MucA
DNA Sequence
>gi|110645304:831913-832497 Pseudomonas aeruginosa PAO1 chromosome, complete genome
TATGAGTCGTGAAGCCCTGCAGGAAACTCTGTCCGCTGTGATGGATAACGAAGCGGATGAACTCGAGTTG
CGGCGGGTGCTCGCAGCTTGCGGCGAGGATGCCGAGCTGCGTTCCACCTGGTCGCGTTACCAGTTGGCGC
GGTCCGTCATGCACCGCGAGCCTACCCTGCCGAAGCTGGATATCGCTGCGGCGGTCTCTGCTGCCCTGGC
CGACGAGGCCGCTCCGCCGAAAGCGGAGAAGGGACCGTGGCGGATGGTCGGTCGCCTGGCGGTCGCTGCC
TCGGTGACCCTGGCGGTGCTGGCCGGCGTGCGTCTGTACAACCAGAACGACGCCCTGCCGCAAATGGCGC
AACAGGGGACCACCCCGCAGATCGCCCTGCCTCAGGTGAAAGGCCCGGCCGTGCTGGCCGGCTACAGCGA
AGAGCAGGGGGCGCCGCAGGTGATCACCAACTCCTCGTCCAGCGATACCCGCTGGCATGAGCAGCGTCTG
CCGATCTACCTGCGTCAGCACGTGCAACAATCCGCCGTCAGTGGTACAGAGAGCGCGCTGCCCTACGCTC
GGGCAGCCAGCCTGGAAAACCGCTG
Protein Sequence
>gi|15595960|ref|NP_249454.1| anti-sigma factor MucA [Pseudomonas aeruginosa PAO1] MSREALQETLSAVMDNEADELELRRVLAACGEDAELRSTWSRYQLARSVMHREPTLPKLDIAAAVSAALADEAAPPKAEKGPWRMVGRLAVAASVTLAVLAGVRLYNQNDALPQMAQQGTTPQIALPQVKGPAVLAGYSEEQGAPQVITNSSSSDTRWHEQRLPIYLRQHVQQSAVSGTESALPYARAASLENR
Molecule Role Virulence factor
Molecule Role Annotation MUTATION: mucA mutant is attenuated in wounded alfalfa seedling infection model (Silo-Suh et al., 2002).
COG COG3073T, under T: Signal transduction mechanisms
References
Silo-Suh et al., 2002: Silo-Suh L, Suh SJ, Sokol PA, Ohman DE. A simple alfalfa seedling infection model for Pseudomonas aeruginosa strains associated with cystic fibrosis shows AlgT (sigma-22) and RhlR contribute to pathogenesis. Proceedings of the National Academy of Sciences of the United States of America. 2002; 99(24); 15699-15704. [PubMed: 12426404].