Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

PA0082

Victor ID 4228
Gene Name PA0082
Sequence Strain (Species/Organism) Pseudomonas aeruginosa PAO1
NCBI Gene ID 879402
NCBI Protein GI 15595280
Locus Tag PA0082
Protein Accession NP_248772.1
Other Database IDs UniProtKB-ID: Q9I750_PSEAE
UniRef100: UniRef100_Q9I750
UniRef90: UniRef90_B7V0W8
UniRef50: UniRef50_A4XUR3
UniParc: UPI00000C4F23
EMBL: AE004091
EMBL-CDS: AAG03472.1
RefSeq_NT: NC_002516.2
GenomeReviews: AE004091_GR
KEGG: pae:PA0082
NMPDR: fig|208964.1.peg.82
PseudoCAP: PA0082
HOGENOM: HBG752183
OMA: DARISEG
ProtClustDB: CLSK865582
BioCyc: PAER208964:PA0082-MONOMER
Taxonomy ID 208964
Gene Starting Position 100123
Gene Ending Position 101157
Gene Strand (Orientation) +
Protein Name hypothetical protein
DNA Sequence
>gi|110645304:100123-101157 Pseudomonas aeruginosa PAO1 chromosome, complete genome
CGTGCTGGATGTACCCGTTTTGCTGGCTGCCGTATCCCCGGACTCGCCCTGTGGCGACGATCTGGAGTAC
GACGCCGCGTTCCTCGAACTCGAACGCATCGCCCAGGGCCAACCCGAGCGCCAGATGGGCGATGCCGTGC
TGCCCGCCGAGCCGCCGGAGTGGCCGCGCGTACGCGCGCTGGCCAGCGAACTGTTCGGCCGTAGCAAGGA
CCTGCGGGTAGCCAACCTGCTGCTGCAGAGCAACGTCGCCCTCGACGGCCTGGACGGGCTCGCCGACGGC
CTGCTGCTGGTCCGCGAGCTGCTCGGCCAGTACTGGGACGGCGTCTATCCGTTGCTCGACGCCGATGACG
ACAACGACCCCACCTTCCGTATCAACGCCCTCACCGGCCTGGTCGCCGAACCGCTGCTGCAACTGGTCTG
GGCGATCCCGCTGGTGCGCTCGCGGGCGTTCGGCCCGGTCAACCTGCGCGCCGCGCTGAACGCCGCCGGG
CTGCAACGCTTCGCCAGCGAGACCCTGAGTCCCGAGCAGATCGCCGGCGCCTTCGCCGATGCCGACGCCG
ATGCGCTGGCCGCCACCCGGCGCGCCCTGGATGGCGCCCAGGAACATGCCCTGGCCATCGAGAGCGGCGT
CGCCGAACGGGTCGGCTCGGCCCAGGGACTCGACCTCGGTCCCCTTCGTCAACTGCTGCGCCAGGCCCTC
CAGGTGTTCGACCTGTACGGCCCGCAGGGCGCCGGCGAGTCCTTGGCGCCGGGTGCCGAGGCGGTCGCCG
ACGAGCAGGTGGGTGCCGCGCCTGTCGCAGCCGTCGCCGCGCCGGCACCGCGAGCCAGCGGCGAGATCGC
CAACCGCGAAGACGTCCTGCGCCAGCTCGATCGCCTGCTCGAGTATTACGTTCGCCACGAGCCGTCGAGT
CCGGTGCCGGTGCTGCTCAAGCGCGCCAAGACACTGGTGACGGCCGACTTCGCCGAAATCGTGAGGAATC
TCATCCCCGATGGGATTTCCCAGTTCGAAACCCTGCGAGGCCCGGAAAGCGAGTA
Protein Sequence
>gi|15595280|ref|NP_248772.1| hypothetical protein PA0082 [Pseudomonas aeruginosa PAO1] MLDVPVLLAAVSPDSPCGDDLEYDAAFLELERIAQGQPERQMGDAVLPAEPPEWPRVRALASELFGRSKDLRVANLLLQSNVALDGLDGLADGLLLVRELLGQYWDGVYPLLDADDDNDPTFRINALTGLVAEPLLQLVWAIPLVRSRAFGPVNLRAALNAAGLQRFASETLSPEQIAGAFADADADALAATRRALDGAQEHALAIESGVAERVGSAQGLDLGPLRQLLRQALQVFDLYGPQGAGESLAPGAEAVADEQVGAAPVAAVAAPAPRASGEIANREDVLRQLDRLLEYYVRHEPSSPVPVLLKRAKTLVTADFAEIVRNLIPDGISQFETLRGPESE
Molecule Role Virulence factor
Molecule Role Annotation MUTATION: PA0082 mutant is attenuated in rats (Lehoux et al., 2002).
COG COG3515S, under S: Function unknown
References
Lehoux et al., 2002: Lehoux DE, Sanschagrin F, Levesque RC. Identification of in vivo essential genes from Pseudomonas aeruginosa by PCR-based signature-tagged mutagenesis. FEMS microbiology letters. 2002; 210(1); 73-80. [PubMed: 12023080].