Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

lasR from Pseudomonas aeruginosa PAO1

Victor ID 4258
Gene Name lasR from Pseudomonas aeruginosa PAO1
Sequence Strain (Species/Organism) Pseudomonas aeruginosa PAO1
NCBI Gene ID 881789
NCBI Protein GI 15596627
Locus Tag PA1430
Protein Accession NP_250121.1
Other Database IDs UniProtKB-ID: LASR_PSEAE
UniRef100: UniRef100_P25084
UniRef90: UniRef90_P25084
UniRef50: UniRef50_P25084
UniParc: UPI000012E231
EMBL: M59425
EMBL: D30813
EMBL: D30812
EMBL: AE004091
EMBL-CDS: AAA25874.1
EMBL-CDS: BAA06490.1
EMBL-CDS: BAA06489.1
EMBL-CDS: AAG04819.1
RefSeq_NT: NC_002516.2
PDB: 2UV0
PDB: 3IX3
PDB: 3IX4
PDB: 3IX8
PDB: 3JPU
GenomeReviews: AE004091_GR
KEGG: pae:PA1430
PseudoCAP: PA1430
HOGENOM: HBG373201
OMA: HCATRAT
ProtClustDB: CLSK866563
BioCyc: PAER208964:PA1430-MONOMER
Taxonomy ID 208964
Gene Starting Position 1558170
Gene Ending Position 1558889
Gene Strand (Orientation) +
Protein Name transcriptional regulator LasR
DNA Sequence
>gi|110645304:1558170-1558889 Pseudomonas aeruginosa PAO1 chromosome, complete genome
TATGGCCTTGGTTGACGGTTTTCTTGAGCTGGAACGCTCAAGTGGAAAATTGGAGTGGAGCGCCATCCTG
CAGAAGATGGCGAGCGACCTTGGATTCTCGAAGATCCTGTTCGGCCTGTTGCCTAAGGACAGCCAGGACT
ACGAGAACGCCTTCATCGTCGGCAACTACCCGGCCGCCTGGCGCGAGCATTACGACCGGGCTGGCTACGC
GCGGGTCGACCCGACGGTCAGTCACTGTACCCAGAGCGTACTGCCGATTTTCTGGGAACCGTCCATCTAC
CAGACGCGAAAGCAGCACGAGTTCTTCGAGGAAGCCTCGGCCGCCGGCCTGGTGTATGGGCTGACCATGC
CGCTGCATGGTGCTCGCGGCGAACTCGGCGCGCTGAGCCTCAGCGTGGAAGCGGAAAACCGGGCCGAGGC
CAACCGTTTCATGGAGTCGGTCCTGCCGACCCTGTGGATGCTCAAGGACTACGCACTGCAGAGCGGTGCC
GGACTGGCCTTCGAACATCCGGTCAGCAAACCGGTGGTTCTGACCAGCCGGGAGAAGGAAGTGTTGCAGT
GGTGCGCCATCGGCAAGACCAGTTGGGAGATATCGGTTATCTGCAACTGCTCGGAAGCCAATGTGAACTT
CCATATGGGAAATATTCGGCGGAAGTTCGGTGTGACCTCCCGCCGCGTAGCGGCCATTATGGCCGTTAAT
TTGGGTCTTATTACTCTCTG
Protein Sequence
>gi|15596627|ref|NP_250121.1| transcriptional regulator LasR [Pseudomonas aeruginosa PAO1] MALVDGFLELERSSGKLEWSAILQKMASDLGFSKILFGLLPKDSQDYENAFIVGNYPAAWREHYDRAGYARVDPTVSHCTQSVLPIFWEPSIYQTRKQHEFFEEASAAGLVYGLTMPLHGARGELGALSLSVEAENRAEANRFMESVLPTLWMLKDYALQSGAGLAFEHPVSKPVVLTSREKEVLQWCAIGKTSWEISVICNCSEANVNFHMGNIRRKFGVTSRRVAAIMAVNLGLITL
Molecule Role Virulence factor
Molecule Role Annotation MUTATION: lasR mutant is attenuated in neonatal mouse model of infection (Tang et al., 1996).
COG COG2771K, under K: Transcription
References
Tang et al., 1996: Tang HB, DiMango E, Bryan R, Gambello M, Iglewski BH, Goldberg JB, Prince A. Contribution of specific Pseudomonas aeruginosa virulence factors to pathogenesis of pneumonia in a neonatal mouse model of infection. Infection and immunity. 1996; 64(1); 37-43. [PubMed: 8557368].