Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

pilI from Pseudomonas aeruginosa UCBPP-PA14

Victor ID 4421
Gene Name pilI from Pseudomonas aeruginosa UCBPP-PA14
Sequence Strain (Species/Organism) Pseudomonas aeruginosa UCBPP-PA14
NCBI Gene ID 4383800
NCBI Protein GI 116054141
Locus Tag PA14_05340
Protein Accession YP_788584.1
Other Database IDs UniProtKB-ID: Q02U02_PSEAB
UniRef100: UniRef100_P43502
UniRef90: UniRef90_P43502
UniRef50: UniRef50_P43502
UniParc: UPI0000131ACB
EMBL: CP000438
EMBL-CDS: ABJ15377.1
RefSeq_NT: NC_008463.1
GenomeReviews: CP000438_GR
KEGG: pau:PA14_05340
eggNOG: COG0835
HOGENOM: HBG701045
OMA: DLCGFFG
ProtClustDB: CLSK865839
BioCyc: PAER208963:PA14_05340-MONOMER
Taxonomy ID 208963
Gene Starting Position 465246
Gene Ending Position 465782
Gene Strand (Orientation) +
Protein Name twitching motility protein PilI
DNA Sequence
>gi|116048575:465246-465782 Pseudomonas aeruginosa UCBPP-PA14, complete genome
CATGTCGGACGTTCAGACCCCCTTCCAGCTCCTCGTCGACATCGATCAGCGCTGCCGACGCCTGGCCGCC
GGCCTGCCGGCCCAGCAGGAGGCGGTGCAGAGCTGGAGCGGGATCGGCTTCCGCATGGGCGGGCGGTTCT
TCGTCGCCCCCATGGGGGAGGTCGGCGAAGTCCTGCACGAACCGCGCTACACCCAGCTGCCGGGCGTGAA
GACCTGGGTCAAGGGGGTGGCCAACGTACGTGGCCGCCTGCTGCCGATCATGGACCTCTGCGGTTTCCTC
GGCACCGAACTGTCGCCCTTGCGCAAGCAGCGGCGGGTGCTGGTGGTGGAGCACCTGGACGTGTTCGCCG
GCCTCATCGTCGATGAGGTGTTCGGCATGCAGCACTTCCCGGTGGACACCTTCAGCGAACAGCTGCCGCC
ACTAGAAGCGGCACTGCAACCCTTCATTCATGGCGTCTTCCATCGAGAGCAGCCGTGGCTGGTGTTCAGC
CCGCATGCGCTGGCGCAACACCAGGGCTTCCTCGACGTCGCCGTATA
Protein Sequence
>gi|116054141|ref|YP_788584.1| twitching motility protein PilI [Pseudomonas aeruginosa UCBPP-PA14] MSDVQTPFQLLVDIDQRCRRLAAGLPAQQEAVQSWSGIGFRMGGRFFVAPMGEVGEVLHEPRYTQLPGVKTWVKGVANVRGRLLPIMDLCGFLGTELSPLRKQRRVLVVEHLDVFAGLIVDEVFGMQHFPVDTFSEQLPPLEAALQPFIHGVFHREQPWLVFSPHALAQHQGFLDVAV
Molecule Role Virulence factor
Molecule Role Annotation MUTATION: pilI mutant is attenuated in rats (Potvin et al., 2003).
COG COG0835NT, under N: Cell motility; T: Signal transduction mechanisms
References
Potvin et al., 2003: Potvin E, Lehoux DE, Kukavica-Ibrulj I, Richard KL, Sanschagrin F, Lau GW, Levesque RC. In vivo functional genomics of Pseudomonas aeruginosa for high-throughput screening of new virulence factors and antibacterial targets. Environmental microbiology. 2003; 5(12); 1294-1308. [PubMed: 14641575].