Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

dsbA

Victor ID 4425
Gene Name dsbA
Sequence Strain (Species/Organism) Pseudomonas aeruginosa UCBPP-PA14
NCBI Gene ID 4385158
NCBI Protein GI 116053639
Locus Tag PA14_72450
Protein Accession YP_793966.1
Other Database IDs UniProtKB-ID: DSBA_PSEAB
UniRef100: UniRef100_Q02DM0
UniRef90: UniRef90_Q02DM0
UniRef50: UniRef50_Q02DM0
UniParc: UPI00001298C0
EMBL: AF116282
EMBL: CP000438
EMBL-CDS: AAD22452.1
EMBL-CDS: ABJ14875.1
RefSeq_NT: NC_008463.1
GenomeReviews: CP000438_GR
KEGG: pau:PA14_72450
eggNOG: COG0526
HOGENOM: HBG680642
OMA: NEIADFM
ProtClustDB: CLSK869391
BioCyc: PAER208963:PA14_72450-MONOMER
Taxonomy ID 208963
Gene Starting Position 6453852
Gene Ending Position 6454487
Gene Strand (Orientation) -
Protein Name thiol:disulfide interchange protein DsbA
DNA Sequence
>gi|116048575:6453852-6454487 Pseudomonas aeruginosa UCBPP-PA14, complete genome
CCTACTTCTTGGCCGCTGCGCGCTCTTTCTCGATCAGGTAGTCGGCCAGCTTGAGGGTTTCCTCCGGACC
ACCGGCGGAGCCGATGTCGAAGCGGTATTTGCCATTGACCACCATGGTCGGTACGCCGGTGACCTGGTAG
GCCATCGCCAGCTTCTTGGCCTTTTCCATCTGGCCCTTGATGGCAAAGGAATTATAGGTGCTCAGGAATT
TTTCCTTGTCCACGCCCTTGCCGGCGAGGAAATCGGCCATCTCTTCCGGAGTGGCGAGCTTCTTGTGCTC
CTTGTGGATCGCCTCGAACACGGCGTTGTGGACGTCATGCTCGACACCCATGCTTTCCAGGGTCAGGAAC
ATCTGCCCATGGACGTTCCAGATACCGCCGAACAGGGCAGGCAGGCGCACGAAATGGACATCTGCCGGCA
GCTTCTCGCTCCACGGCACGATGGTCGGCTCGAACGCGTAGCAATGCGGGCAGCCATACCAGAACAGTTC
CACCACTTCGATCTTGCCCGGCTGGGACACCGGCACCGGGCTGCTCAGCTCGACGTATTCCTTGCCGGCG
GTATAGTCGTCGGCCTGGGCGGCCATGCCGAACAGGCTGGCCATGGCCAGCATGGCGGTGAGAATCAGGT
TACGCA
Protein Sequence
>gi|116053639|ref|YP_793966.1| thiol:disulfide interchange protein DsbA [Pseudomonas aeruginosa UCBPP-PA14] MRNLILTAMLAMASLFGMAAQADDYTAGKEYVELSSPVPVSQPGKIEVVELFWYGCPHCYAFEPTIVPWSEKLPADVHFVRLPALFGGIWNVHGQMFLTLESMGVEHDVHNAVFEAIHKEHKKLATPEEMADFLAGKGVDKEKFLSTYNSFAIKGQMEKAKKLAMAYQVTGVPTMVVNGKYRFDIGSAGGPEETLKLADYLIEKERAAAKK
Molecule Role Virulence factor
Molecule Role Annotation MUTATION: dsbA mutant is attenuated in Drosophila melanogaster and in mice (Kim et al., 2008).
COG COG1651O, under O: Posttranslational modification, protein turnover, chaperones
References
Kim et al., 2008: Kim SH, Park SY, Heo YJ, Cho YH. Drosophila melanogaster-based screening for multihost virulence factors of Pseudomonas aeruginosa PA14 and identification of a virulence-attenuating factor, HudA. Infection and immunity. 2008; 76(9); 4152-4162. [PubMed: 18591226].