Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

nsp 3a

Victor ID 4965
Gene Name nsp 3a
Sequence Strain (Species/Organism) Feline infectious peritonitis virus
NCBI Gene ID 10040181
NCBI Protein GI 315192965
Locus Tag FIPV_gp03
Genbank Accession AY994055
Protein Accession YP_004070195
Taxonomy ID 11135
Gene Starting Position 24860
Gene Ending Position 25075
Gene Strand (Orientation) ?
Protein Name putative 3a protein
Protein pI 4.49
Protein Weight 6974.53
Protein Length 71
DNA Sequence
>gi|315192962:24860-25075 Feline infectious peritonitis virus, complete genome
TATGGACATTGTCAAATCTATTGACATATTCGTAGACGCTGTACTTGACGAACTTGACCGTGCATACTTT
GCTGTAACTCTTAAAGTAGAATTTAAGACTGGTAAACTACTTGTGTGTATAGGTTTTGGTGACACACTTC
TTGAGGCTAAGGACAAAGCGTATGCTAAGCTTGGTCTCTCCTTTATTGAAGAAGTCAATAGTCATACAGT
TGTTTA

Protein Sequence
>gi|315192965|ref|YP_004070195.1| putative 3a protein [Feline infectious peritonitis virus]
MDIVKSIDIFVDAVLDELDRAYFAVTLKVEFKTGKLLVCIGFGDTLLEAKDKAYAKLGLSFIEEVNSHTV
V

Molecule Role Virulence factor
Molecule Role Annotation MUTATION: A 3abc deletion mutant in Feline infectious peritonitis virus (FIPV) was attenuated in kittens (Haijema et al., 2004)
References
Haijema et al., 2004: Haijema BJ, Volders H, Rottier PJ. Live, attenuated coronavirus vaccines through the directed deletion of group-specific genes provide protection against feline infectious peritonitis. Journal of virology. 2004; 78(8); 3863-3871. [PubMed: 15047802].