Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

nsp 7a

Victor ID 4968
Gene Name nsp 7a
Sequence Strain (Species/Organism) Feline infectious peritonitis virus
NCBI Gene ID 10040187
NCBI Protein GI 315192970
Locus Tag FIPV_gp09
Genbank Accession AY994055
Protein Accession YP_004070200
Taxonomy ID 11135
Gene Starting Position 28151
Gene Ending Position 28456
Gene Strand (Orientation) ?
Protein Name non-structural protein 7a
Protein pI 8.52
Protein Weight 9843.18
Protein Length 101
DNA Sequence
>gi|315192962:28151-28456 Feline infectious peritonitis virus, complete genome
CATGCTCGTTTTCGTCCATGCTGTACTTGTAACAGCTTTAATCTTACTACTAATTGGTAGAATCCAATTA
CTAGAAAGGTTGTTACTCAGTCATCTGCTTAATCTTACAACAGTCAGTAATGTTTTAGGTGTGCCTGACA
GTAGTCTGCGTGTAAATTGTTTGCAGCTTTTGAAACCAGACTGCCTTGATTTTAATATCTTACATAAAGT
TTTAGCAGAAACCAGGTTACTAGTAGTAGTACTGCGAGTGATCTTTCTAGTTCTTCTAGGGTTTTCCTGC
TATACATTGTTGGGTGCATTATTTTA

Protein Sequence
>gi|315192970|ref|YP_004070200.1| non-structural protein 7a [Feline infectious peritonitis virus]
MLVFVHAVLVTALILLLIGRIQLLERLLLSHLLNLTTVSNVLGVPDSSLRVNCLQLLKPDCLDFNILHKV
LAETRLLVVVLRVIFLVLLGFSCYTLLGALF

Molecule Role Virulence factor
Molecule Role Annotation MUTATION: A 7ab deletion mutant in Feline infectious peritonitis virus is attenuated in kittens (Haijema et al., 2004).
References
Haijema et al., 2004: Haijema BJ, Volders H, Rottier PJ. Live, attenuated coronavirus vaccines through the directed deletion of group-specific genes provide protection against feline infectious peritonitis. Journal of virology. 2004; 78(8); 3863-3871. [PubMed: 15047802].