Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

nsp 7b

Victor ID 4969
Gene Name nsp 7b
Sequence Strain (Species/Organism) Feline infectious peritonitis virus
NCBI Gene ID 10040188
NCBI Protein GI 315192971
Locus Tag FIPV_gp10
Genbank Accession AY994055
Protein Accession YP_004070201
Taxonomy ID 11135
Gene Starting Position 28461
Gene Ending Position 29081
Gene Strand (Orientation) ?
Protein Name non-structural protein 7b
Protein pI 7.25
Protein Weight 22221.54
Protein Length 206
DNA Sequence
>gi|315192962:28461-29081 Feline infectious peritonitis virus, complete genome
CATGATTGTTGTAATCCTTGTGTGTATCTTTTTGGCTAATGGAATTAAAGCTACTGCTGTGCAAAATGAC
CTTCATGAACATCCCGTTCTTACCTGGGATTTATTACAGCATTTCATAGGACATACCCTCTACATTACAA
CACACCAGGTCTTAGCACTACCGCTTGGATCTCGTGTTGAGTGTGAGGGTATCGAAGGTTTCAATTGCAC
ATGGCCTGGCTTTCAAGATCCTGCACATGATCATATTGATTTCTACTTTGATCTTTCTAATCCTTTCTAT
TCATTTGTAGATAATTTTTATATTGTAAGTGAGGGAAATCAAAGAATCAATCTCAGATTGGTTGGTGCTG
TGCCAAAACAAAAGAGATTAAATGTTGGTTGTCATACATCATTTGCTGTTGATCTTCCATTTGGGATTCA
GATATACCATGACAGGGATTTTCAACACCCTGTTGATGGCAGACATCTAGATTGTACTCACAGAGTGTAC
TTTGTGAAGTACTGTCCACATAACCTGCATGGTTATTGCTTTAATGAGAGGCTGAAAGTTTATGACTTGA
AGCAATTCAGAAGCAAGAAGGTCTTCGACAAAATCAACCAACATCATAAAACTGAGTTATA

Protein Sequence
>gi|315192971|ref|YP_004070201.1| non-structural protein 7b [Feline infectious peritonitis virus]
MIVVILVCIFLANGIKATAVQNDLHEHPVLTWDLLQHFIGHTLYITTHQVLALPLGSRVECEGIEGFNCT
WPGFQDPAHDHIDFYFDLSNPFYSFVDNFYIVSEGNQRINLRLVGAVPKQKRLNVGCHTSFAVDLPFGIQ
IYHDRDFQHPVDGRHLDCTHRVYFVKYCPHNLHGYCFNERLKVYDLKQFRSKKVFDKINQHHKTEL

Molecule Role Virulence factor
Molecule Role Annotation MUTATION: A 7ab deletion mutant in Feline infectious peritonitis virus is attenuated in kittens (Haijema et al., 2004).
References
Haijema et al., 2004: Haijema BJ, Volders H, Rottier PJ. Live, attenuated coronavirus vaccines through the directed deletion of group-specific genes provide protection against feline infectious peritonitis. Journal of virology. 2004; 78(8); 3863-3871. [PubMed: 15047802].