Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

M2-2

Victor ID 4982
Gene Name M2-2
NCBI Protein GI 81925031
Other Database IDs CDD:116003
Taxonomy ID 11259
Gene Strand (Orientation) ?
Protein Name Matrix M2-2
Protein Length 90
Protein Note Matrix M2-2. /FTId=PRO_0000356857.
Protein Sequence
>gi|81925031|sp|P88812.1|M22_HRSVA RecName: Full=Matrix M2-2
MTMPKIMILPDKYPCSITSILITSRCRVTMYNQKNTLYFNQNNPNNHMYSPNQTFNEIHWTSQELIDTIQ
NFLQHLGIIEDIYTIYILVS

Molecule Role Virulence factor
Molecule Role Annotation MUTATION: An M2-2 mutant of human respiratory syncytial virus A2 is attenuated in African green monkeys (Jin et al., 2003).
References
Jin et al., 2003: Jin H, Cheng X, Traina-Dorge VL, Park HJ, Zhou H, Soike K, Kemble G. Evaluation of recombinant respiratory syncytial virus gene deletion mutants in African green monkeys for their potential as live attenuated vaccine candidates. Vaccine. 2003; 21(25-26); 3647-3652. [PubMed: 12922094].