Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

nef

Victor ID 5009
Gene Name nef
Sequence Strain (Species/Organism) Simian immunodeficiency virus
NCBI Gene ID 1490008
NCBI Protein GI 9627209
Locus Tag SIVgp7
Genbank Accession M66437
Protein Accession NP_054373
Taxonomy ID 11723
Gene Starting Position 8599
Gene Ending Position 9270
Gene Strand (Orientation) ?
Protein Name nef protein
Protein pI 6.4
Protein Weight 24504.09
Protein Length 223
DNA Sequence
>gi|9627204:8599-9270 Simian immunodeficiency virus, complete genome
TATGGGCTCCAGCAACTCCAAGAGGCAGCAACAGGGCTTGCTCAAGCTCTGGCGAGGGCTGCGAGGGAAG
CCTGGGGCAGACTGGGTGCTATTGTCCGATCCGCTTATCGGGCAGTCATCAACAGTCCAAGAAGAGTGCG
GCAAGGCCTTGAAAAAGTCCTGGGGTAAAGGTAAAATGACTCCAGACGGCCGCCGCCTGCAAGAAGGAGA
CACCTTTGATGAGTGGGATGATGATGAAGAAGAAGTAGGCTTCCCTGTGCAACCTCGAGTCCCCTTAAGA
CAGATGACCTATAAATTAGCAGTGGACTTTTCCCACTTTTTAAAATCAAAGGGGGGACTGGATGGGATAT
ATTACTCTGAAAGAAGAGAAAAGATCCTGAATTTGTATGCCTTGAACGAGTGGGGAATAATAGATGATTG
GCAAGCTTACTCACCAGGCCCGGGGATAAGGTACCCGAGAGTCTTTGGCTTCTGCTTTAAGCTAGTCCCA
GTGGACCTGCATGAGGAGGCACGCAACTGTGAGAGACACTGTCTGATGCATCCAGCACAGATGGGGGAAG
ATCCTGATGGAATAGATCATGGAGAAGTCTTGGTCTGGAAGTTTGACCCGAAGTTGGCGGTGGAGTACCG
CCCGGACATGTTTAAGGACATGCACGAACATGCAAAGCGCTA

Protein Sequence
>gi|9627209|ref|NP_054373.1| nef protein [Simian immunodeficiency virus]
MGSSNSKRQQQGLLKLWRGLRGKPGADWVLLSDPLIGQSSTVQEECGKALKKSWGKGKMTPDGRRLQEGD
TFDEWDDDEEEVGFPVQPRVPLRQMTYKLAVDFSHFLKSKGGLDGIYYSERREKILNLYALNEWGIIDDW
QAYSPGPGIRYPRVFGFCFKLVPVDLHEEARNCERHCLMHPAQMGEDPDGIDHGEVLVWKFDPKLAVEYR
PDMFKDMHEHAKR

Molecule Role Virulence factor
Molecule Role Annotation MUTATION: A SIV nef mutant is attenuated in rhesus monkeys (Daniel et al., 1992).
References
Daniel et al., 1992: Daniel MD, Kirchhoff F, Czajak SC, Sehgal PK, Desrosiers RC. Protective effects of a live attenuated SIV vaccine with a deletion in the nef gene. Science (New York, N.Y.). 1992; 258(5090); 1938-1941. [PubMed: 1470917].