Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

NSs

Victor ID 5083
Gene Name NSs
NCBI Nucleotide GI 3006114
NCBI Protein GI 3006115
Protein Accession CAA73290.1
Other Database IDs CDD:256277
UniProtKB/TrEMBL: O73549
Taxonomy ID 11588
Gene Strand (Orientation) ?
Protein Length 200
Protein Note Rift valley fever virus non structural protein (NSs) like; pfam11073
DNA Sequence
>gi|3006114|emb|Y12756.1| Rift valley fever virus NSs gene, partial, strain ZH548
GTACTTTAGAGGAGATGGTCCTCCCAGGATACCTTATTCTATGGTTGGGCCCTGTTGTGTCTTTCTCATG
CACCATCGTCCTAGTCACGAGGTTCGCTTGCGATTCTCTGATTTCTACAATGTCGGAGAATTCCCATACC
GAGTCGGACTTGGAGACTTTGCATCAAACGTTGCACCTCCACCAGCGAAGCCTTTTCAGAGACTTATTGA
TCTAATAGGCCATATGACTCTTAGTGATTTCACAAGGTTCCCCAATCTGAAAGAAGCCATATCCTGGCCT
CTTGGAGAACCCTCACTGGCTTTCTTTGACCTAAGCTCGACTAGAGTGCATAGGAATGATGACATTAGAA
GGGATCAGATTGCCACTCTAGCAATGAGGAGTTGCAAGATCACCAATGATCTAGAGGACTCCTTTGTTGG
CTTACACAGGATGATAGCGACTGAGGCCATCCTCAGAGGGATTGACCTGTGCCTGTTGCCAGGCTTTGAT
GTCATGTATGAGGTTGCTCACGTACAGTGCGTTCGGCTTCTGCAAGCAGCAAAAGAGGACATTTCTAATG
CTGTAGTTCCAAACTCAGCCCTCATTGTTCTTATGGAGGAGA

Protein Sequence
>gi|3006115|emb|CAA73290.1| NSs, partial [Rift Valley fever virus]
YFRGDGPPRIPYSMVGPCCVFLMHHRPSHEVRLRFSDFYNVGEFPYRVGLGDFASNVAPPPAKPFQRLID
LIGHMTLSDFTRFPNLKEAISWPLGEPSLAFFDLSSTRVHRNDDIRRDQIATLAMRSCKITNDLEDSFVG
LHRMIATEAILRGIDLCLLPGFDVMYEVAHVQCVRLLQAAKEDISNAVVPNSALIVLMEE

Molecule Role Virulence factor
Molecule Role Annotation In this report, we show that MP12 and clone 13, two attenuated RVFV strains with mutations in the NSs gene, Clone 13 has a defective NSs gene with a large in-frame deletion.
(Bouloy et al., 2001)
References
Bouloy et al., 2001: Bouloy M, Janzen C, Vialat P, Khun H, Pavlovic J, Huerre M, Haller O. Genetic evidence for an interferon-antagonistic function of rift valley fever virus nonstructural protein NSs. Journal of virology. 2001; 75(3); 1371-1377. [PubMed: 11152510].