Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

ORFV121

Victor ID 5103
Gene Name ORFV121
NCBI Protein GI 74230834
Other Database IDs CDD:222914
Taxonomy ID 10258
Gene Strand (Orientation) ?
Protein Name hypothetical protein
Protein Length 306
Protein Note hypothetical protein; Provisional
Protein Sequence
>gi|74230834|gb|ABA00639.1| hypothetical protein [Orf virus]
MAGFLGAFRGVCSDLWQSLRGHGHHSSSCPRRRANSMDDRDRRRHRHREIPNSSASLNSDPMPQRSAGAR
RHYDCRPSEKSRHSSDKHHSADRHHSADRHQSADRDRHRRSRKNYDSHPSRRNRNYERADYQRHPSQTHP
DAPAQTSTLKVTSLSTSCSTLSQHHYETPDHIYDIPEDSRGASAPPRADLALPPLAMPKSKPRRTRPASM
NDCLMKHCGAGRPNLQDDICTLCTDIETQLSALEKSLESELNFYRRYIQDTKTLLATRAANIGSKALIYT
DDYNGSGDVGEKEHCSEECCKVEEVL

Molecule Role Virulence factor
Molecule Role Annotation The infection of cells with an ORFV121 deletion mutant virus (OV-IA82Δ121) resulted in increased NF-κB-mediated gene transcription, and the expression of ORFV121 in cell cultures significantly suppressed NF-κB-regulated reporter gene expression. Notably, the deletion of ORFV121 from the viral genome markedly decreased ORFV virulence and disease pathogenesis in sheep, indicating that ORFV121 is a virulence determinant for ORFV in the natural host.(Diel et al., 2011)
References
Diel et al., 2011: Diel DG, Luo S, Delhon G, Peng Y, Flores EF, Rock DL. Orf virus ORFV121 encodes a novel inhibitor of NF-kappaB that contributes to virus virulence. Journal of virology. 2011; 85(5); 2037-2049. [PubMed: 21177808].