Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

tolC

Victor ID 5194
Gene Name tolC
Sequence Strain (Species/Organism) Legionella pneumophila str. Lens
NCBI Gene ID 3114064
NCBI Protein GI 54293683
Locus Tag lpl0736
Genbank Accession CR628337
Protein Accession YP_126098
Taxonomy ID 297245
Gene Starting Position 836408
Gene Ending Position 837775
Gene Strand (Orientation) -
Protein Name hypothetical protein
Protein pI 9.1
Protein Weight 47360.95
Protein Length 455
Protein Note similar to outer membrane protein TolC
DNA Sequence
>gi|54292964:836408-837775 Legionella pneumophila str. Lens, complete genome
GTTATTTGGAGGTTTTGTTATCTACGGGTGAAAATCCATTGACACGTGTAGTTGCTAACCATGAGTTAAT
CTGTTCGAGATCATTAACGTTTAAAGTCCCTGCAAGGTACTTCAGGGTAAGTATGGAGTTAATCAAATCG
TATTGATCCCGGGCTAATTGTTCCTGTGCTTCAAACAATCTTTGCTGAGCATTGACCACATCTACCATGG
TTCGAGTGCCTACTTCAAATTGAGCCTCGGTACTTTGCAAAGAATTTTGCACAGAGATGACCGTTTGTCT
GTCCGCCTTTACCTTGCTTATCCCATCAGTGATGGTATTGAAAGCAATGCGGCTGTTTACAACGACATCG
CGATACGTTTGTTCCAGTTTTTCACTCGTTGACTGAAAATTATATTGAGCTTGACGAGTCTGAGCCTGGA
CCAGGCCTCCTTGAAAAACAGGAAAATTCATCGCGATTGCAATATTAGCCTGGGTTTGCTTTGATGGAAT
AAAAACAGTATTACCAGATGCATTATTATGTACCTGGCTGGCGTTGCTCTGTAGTGAAAAAACTGGCCAG
TTGCCCGCAGAGATTGCTTTTACATTGTCTTTTGCCACCTCAAGATTATATTTTGCAGCATATAATTTAT
AGTTTTGTTTAAGTCCGGTATCTATCCATTGATTCACGTCATTTGGTTCTGGCTTAACAAGAGGAATTTT
GCTGTCTTTGAGTGGCGCGAGTGTTTCGTATACGTGATTAGTAAGTTTTCGTAAATTTTCACTCTGGTTA
ATCTGATTATTGCGGGCAGCGATAACTGTCGCTATGGATTGATCGTACGCCGCCTTGGCTTCATAGACAG
AAGTGATGGCATCCAGGCCAACTTGAAAACGTTGAGTTGCTTGATCATATTGTCTTTTGTTCGCCCGTTT
TTTTGCTTCGGCAAAGTCTAATGTGTCTTTGGCAAACAGGACATCAAAATAGGCTTTGGCTGTTCTTAGA
ATTAAATTCTGTGCTGCATCATTGAAACTGGCTTGTGCTGCTTTAACAGACGCTTTGGCCTGGGCGACTT
TGGCCCATGCCTGATAGTTAAACAGCGCCTGGGAAGCATTGACTTGCCATGAATAATTTCCATAGTATTG
ATTGGCACTGAACGCTCCGGCAACAGCATCCTGATAATTGCGGCCAGCTTGTGAACCAAGGCCGACTTGA
GGGTAAAGAGCCGCACGAGCTTGGGGAATGGCTTCGGTGCTGGACATATAGTTATCATATGCCTCTTTAA
AAATGGTATCGTTCTCCAGAGCTTGTTGATAGATATCCATTAGGTCTGTTGCAAACACATGGGTTGAAAC
ACCTAAAGTTAAAATCCAACAAAACAGAGATTTTCTCA

Protein Sequence
>gi|54293683|ref|YP_126098.1| hypothetical protein lpl0736 [Legionella pneumophila str. Lens]
MRKSLFCWILTLGVSTHVFATDLMDIYQQALENDTIFKEAYDNYMSSTEAIPQARAALYPQVGLGSQAGR
NYQDAVAGAFSANQYYGNYSWQVNASQALFNYQAWAKVAQAKASVKAAQASFNDAAQNLILRTAKAYFDV
LFAKDTLDFAEAKKRANKRQYDQATQRFQVGLDAITSVYEAKAAYDQSIATVIAARNNQINQSENLRKLT
NHVYETLAPLKDSKIPLVKPEPNDVNQWIDTGLKQNYKLYAAKYNLEVAKDNVKAISAGNWPVFSLQSNA
SQVHNNASGNTVFIPSKQTQANIAIAMNFPVFQGGLVQAQTRQAQYNFQSTSEKLEQTYRDVVVNSRIAF
NTITDGISKVKADRQTVISVQNSLQSTEAQFEVGTRTMVDVVNAQQRLFEAQEQLARDQYDLINSILTLK
YLAGTLNVNDLEQINSWLATTRVNGFSPVDNKTSK

Molecule Role Virulence factor
Molecule Role Annotation Deletion of tolC by allelic exchange in L. pneumophila caused increased sensitivity to various drugs. The complementation of the tolC mutation in trans restored drug resistance, indicating that TolC is involved in multi-drug efflux machinery. In addition, deletion of tolC caused a significant attenuation of virulence towards both amoebae and macrophages.(Ferhat et al., 2009)
References