Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

iraA

Victor ID 5216
Gene Name iraA
Sequence Strain (Species/Organism) Legionella pneumophila str. Paris
NCBI Gene ID 3116645
NCBI Protein GI 54296774
Locus Tag lpp0813
Genbank Accession CR628336
Protein Accession YP_123143
Taxonomy ID 297246
Gene Starting Position 911036
Gene Ending Position 911854
Gene Strand (Orientation) -
Protein Name small-molecule methyltransferase IraA
Protein pI 9.12
Protein Weight 29766.3
Protein Length 272
DNA Sequence
>gi|54295983:911036-911854 Legionella pneumophila str. Paris, complete genome
ATCACTTCCTGGCAAGAACTACATCAATAATATGAGTGTCATGGTAGGGAAAAGTAAAGATTTTGCTGAA
AAGTCGTTTAAGACGCTGAATTAAAAAATATTTTGGCAGCATGCGTATCGATAGAGTGTTAAGAAACCAG
GTGCCTTCTATTCCAAACAGTGCCAATTCATCAATGTTATTAAGGGTAATGGGTATTTCAATACGTTGGT
GATCCAAAATATTAAATTGATGCTGTTTAAATGCCAGCAAGAGTTCATCGAGATTTGCAGCAACAGTTGT
ATTTTTGACTATGGATTTATAGTAGTGACCAACAACTCGACTTAAAATAGTATCCTGAGCAATGAAGTTG
GCCAGTTGTTGTTGCGCTACAGGAAAAGAATCATAGGTCGTTGTGATTAAAGAGAAGTGACCATTGGCAC
GCGTCAAGTATTTGGCTTCATCAAAGAGAACATTAATAGGGATATATGCATTAATAAAATGAGCCAGAAC
CAAGTCCTGGCTATGTGCGGGCAAAAACTTGTTGGCTTCTGCAGCACTGCCTTCAATGGTTGTTAAAGGA
AGGGCTTCGCTCGCTCGTTTCAACATTTCTGATGAAACATCAATTCCTGTGAAATTGGCCATTGGCATTA
AGTGATGCAATTTTTGCAAAAAAGAGCCATTGCCAACGCCCAGATCGAGGATTTTATAATGGGGTTTCAA
CCCCAAATGAAATTTCCTCATCTGCTCAATGGCAACGTGATGGCTTTCACTAATTGAACCAAAACGATTA
GCTGTCGCGTAATTTTCTGCGATTTGGTTATACATGGCCTTCAAGGACA

Protein Sequence
>gi|54296774|ref|YP_123143.1| small-molecule methyltransferase IraA [Legionella pneumophila str. Paris]
MSLKAMYNQIAENYATANRFGSISESHHVAIEQMRKFHLGLKPHYKILDLGVGNGSFLQKLHHLMPMANF
TGIDVSSEMLKRASEALPLTTIEGSAAEANKFLPAHSQDLVLAHFINAYIPINVLFDEAKYLTRANGHFS
LITTTYDSFPVAQQQLANFIAQDTILSRVVGHYYKSIVKNTTVAANLDELLLAFKQHQFNILDHQRIEIP
ITLNNIDELALFGIEGTWFLNTLSIRMLPKYFLIQRLKRLFSKIFTFPYHDTHIIDVVLARK

Molecule Role Virulence factor
Molecule Role Annotation NU216R-infected animals yielded 1,000-fold fewer bacteria from their lungs and spleen compared to wild-type-130b-infected animals that had received a 50-fold-lower dose. Moreover, NU216R-infected animals subsequently cleared the bacteria from these sites.(Viswanathan et al., 2000)
References
Viswanathan et al., 2000: Viswanathan VK, Edelstein PH, Pope CD, Cianciotto NP. The Legionella pneumophila iraAB locus is required for iron assimilation, intracellular infection, and virulence. Infection and immunity. 2000; 68(3); 1069-1079. [PubMed: 10678909].