Search: for Help
About
Introduction
Statistics
Your PHIDIAS
Register or Login
Philert
Submission
Curated Data
Victors
BBP (Brucella)
Phinfo
Phinet
HazARD
Data Analysis
Phigen
Pacodom
BLAST
Help & Documents
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Cathepsin L proteases

Victor ID 5220
Gene Name Cathepsin L proteases
NCBI Protein GI 452266
Other Database IDs CDD:239068
GOA:Q24948
HSSP: 1K3B
InterPro: IPR000169
InterPro: IPR000668
InterPro: IPR013128
UniProtKB/TrEMBL: Q24948
Taxonomy ID 6192
Gene Strand (Orientation) ?
Protein Name cathepsin L-like protease
Protein Length 166
Protein Note Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W). Papain is an endopeptidase with specific substrate preferences; cd02248
Protein Sequence
>gi|452266|emb|CAA80450.1| cathepsin L-like protease, partial [Fasciola hepatica]
QGQCGTCWAFSTTGTMEGQYMKKQRTSISFSDEQLVDCSRPWGNNGCGGGLMENAYQYLKQFGLETESSY
PYTAVEGQCRYNEQLGVAKVTGYYTVHSGSEVELKNLVGSEGPARSPVDVESDFMMYRSGIYQSQTCLPF
ALNHAVLAVGYGTQDGTDYWIVKNSW

Molecule Role Virulence factor
Molecule Role Annotation cathepsin L cysteine peptidases (FhCL) correlates with the entry and migration of the helminth pathogen Fasciola hepatica in the host.
(Robinson et al., 2011)
References
Robinson et al., 2011: Robinson MW, Corvo I, Jones PM, George AM, Padula MP, To J, Cancela M, Rinaldi G, Tort JF, Roche L, Dalton JP. Collagenolytic activities of the major secreted cathepsin L peptidases involved in the virulence of the helminth pathogen, Fasciola hepatica. PLoS neglected tropical diseases. 2011; 5(4); e1012. [PubMed: 21483711].